KEGG   Homo sapiens (human): 254879Help
Entry
254879            CDS       T01001                                 

Gene name
OR2T6, OR2T6P, OR2T9, OST703
Definition
(RefSeq) olfactory receptor family 2 subfamily T member 6
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    254879 (OR2T6)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    254879 (OR2T6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 DUF2768
Motif
Other DBs
NCBI-GeneID: 254879
NCBI-ProteinID: NP_001005471
HGNC: 15018
Ensembl: ENSG00000198104
Vega: OTTHUMG00000040448
Pharos: Q8NHC8(Tdark)
UniProt: Q8NHC8
Position
1q44
AA seq 308 aa AA seqDB search
MNENNETLTRGFTLMGLFTHNKCSGFFFGVICAVFFMAMIANGVMIFLINIDPHLHTPMY
FLLSHLSVIDTLYISTIVPKMLVDYLMGEGTISFIACTAQCFLYMGFMGAEFFLLGLMAY
DRYVAICNPLRYPVLISWRVCWMILASSWFGGALDSFLLTPITMSLPFCASHQINHFFCE
APTMLRLACGDKTTYETVMYVCCVAMLLIPFSVVTASYTRILITVHQMTSAEGRKKAFAT
CSSHMMVVTLFYGAALYTYTLPQSYHTPIKDKVFSAFYTILTPLLNPLIYSLRNRDVMGA
LKRVVARC
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaacaatgaaaccttgaccagaggctttaccctcatggggctcttcactcac
aataaatgctcaggattctttttcggtgtcatttgtgccgtcttcttcatggccatgata
gctaatggggtcatgatcttcctgattaacatagaccctcatctccacacccccatgtac
ttcctcctcagccacctctccgtcattgacacattatacatctccaccattgtgcccaag
atgctggtagattatctcatgggcgaggggaccatctctttcatcgcctgcactgctcag
tgctttctctacatgggctttatgggggctgaattcttcctgctggggctcatggcctat
gaccgctacgtggccatctgcaacccactgcgctatcctgtcctcatcagctggcgggtc
tgctggatgatcctggccagctcttggttcggtggggctttggacagttttctcctcacc
cccattaccatgagtctcccgttctgtgcctctcaccaaatcaatcactttttctgtgag
gcacccaccatgctgaggctggcctgtggggacaaaaccacctatgaaacagtgatgtat
gtgtgctgcgttgcaatgctgctgatccccttctcggtggtgactgcatcctacaccagg
attctcatcacagtgcatcagatgacatcggctgaagggaggaagaaggcctttgccacc
tgctcttcacacatgatggtggtgacattgttctatggggctgccttgtatacgtatacg
cttccccaatcttaccacaccccaatcaaagataaggtcttctctgccttttataccatc
ctcacacccttattaaaccctctcatctacagtctgaggaacagggatgtgatgggtgcc
ttgaagagagttgtggcaagatgttag

DBGET integrated database retrieval system