KEGG   Homo sapiens (human): 254958Help
Entry
254958            CDS       T01001                                 

Gene name
REXO1L1P, GOR, REXO1L1
Definition
REX1, RNA exonuclease 1 homolog (S. cerevisiae)-like 1, pseudogene
Orthology
K14570  
RNA exonuclease 1 [EC:3.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:hsa03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q21.2
AA seq 675 aa AA seqDB search
MLRATAPCWFPPGYPEAKKVAEEAALEASRHLGGEQSQAGAPEGSKMLRATAPCWFRPGY
PEAKKVAKEAAPEASRHLGAEQSPAGAPEGSKMLRATAPCWFPPGYPEAKKVAEEAALEA
PEFPLPSHQPAQSFGLWVPQMHKQASAFVDIQAEPQNRGPAVPPAWPKMVTESCYFPAQR
GSACRLPAAPRLTERPSGVRISAPRKRKTIAHSSSPCLVTGYTDAKRTRVASSSQRSRGS
KVGRQPGKTRNRSGMACKTTATTSSKRIVRRASLPSLSLKKPIILRSSGCQVPTVLRRGY
LQLFTEECLKFCASKQEAEEKALNEEKVAYDCSPNKNRYLNVVLNTLKRLKGLTPSSMPG
LSRAALYSRLQEFLLTQDQLKENGYPFPHPERPGGAVLFTGQGKGPGDSSCRVCCRCGTE
YLVSSSGRCVRDQLCYYHWGRVRSSQVAGGRVSQYTCCAAAPGSVGCQVAKQHVRDGRKE
SLDGFVETFKKELSRDAYPGIYALDCEMCYTTHGLELTRVTVVDADMRVVYDTFVKPDNE
IVDYNTRFSGVTEADVAKTSITLPQVQAILLSFFSAQTILIGHSLESDLLALKLIHSTVV
DTAVLFPHYLGFPYKRSLRNLAADYLAQIIQDSQDGHNSSEDASACLQLVMWKVRQRAQI
QPRHRSASPAALACP
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgagccacagctccctgctggttcccccctggatacccagaagctaagaaggtg
gccgaggaggcggccctggaggcaagccgccatttgggaggggagcagagccaggccggt
gctcccgaaggcagcaagatgttgcgagccacagctccctgctggttccgccctggatac
ccagaagctaagaaggtggccaaggaggcggccccggaggcaagccgccatttgggagcg
gagcagagcccggccggtgctcccgaaggcagcaagatgttgcgagccacagctccctgc
tggttcccacctggatacccagaagctaagaaggtggccgaggaggcggccctcgaggct
ccagaattcccactgccctctcatcagcctgcccagagcttcgggctctgggtgccccag
atgcacaagcaggcctcagcatttgtggacatccaggcggagccccaaaacaggggtccg
gcggtgcccccagcgtggcccaagatggtgacggagtcgtgctacttccctgcgcagagg
ggatcggcctgccgcttgccagccgccccaaggctgacagagaggccctcgggagtccgc
atctcagcccccaggaagaggaagacgatcgcccactcttccagcccttgcttggtcaca
ggttacacagatgccaagagaacccgggtggccagcagcagccaacgctcccgtggctcc
aaggtcggcagacagccagggaagacgcgcaacaggtcagggatggcatgcaagaccacc
gccaccaccagctctaagcgaatcgtccgtcgtgcatccttaccgagtttgagtttgaag
aaacccattatcctccgaagctctgggtgccaagtccccaccgtcctccgccgaggctat
ctccaactgttcaccgaagagtgtctcaagttctgcgcctccaagcaggaggccgaggag
aaggcgctgaacgaggagaaggtggcctacgactgcagccccaacaagaacaggtacctg
aacgtggtcctgaacaccctcaagagactgaagggcctgacccccagctccatgcccggc
ctcagcagggccgccctgtacagccgcctccaggagttcctgctcacccaggaccagctc
aaggagaacggctaccccttcccgcaccccgagcggcccggaggcgccgtcctcttcact
ggccaggggaaggggcccggcgactcctcctgtagggtctgctgccgttgtggcaccgag
tacctggtgtcctcctcgggccgctgtgtacgcgaccagttgtgttattatcactggggg
cgggtccgctcgagccaggtggctggaggccgggttagccagtacacctgctgtgcagct
gctcctggctctgtgggctgccaggtggcaaagcagcacgtgcgggacggccgcaaggag
agcctcgatggcttcgtggagaccttcaagaaagagttgtccagagacgcttatccagga
atctacgccttggactgtgagatgtgctacaccacgcatggcctagagctgacccgcgtc
accgtggtggacgccgacatgcgagtggtgtacgacaccttcgtcaagcccgacaacgag
atcgtggactacaacaccaggttttccggagtcaccgaggccgacgtcgccaagacgagc
atcacgttgccccaagtccaagccatcctgctgagctttttcagcgcccaaaccatcctc
atcgggcacagcctggagagcgacctgctggccctgaagctcatccacagcaccgtggtg
gacacggccgtgctcttcccgcactacctgggtttcccctacaagcgctccctcaggaat
ctcgcggccgactacctggcacagatcatccaggacagccaggacggccacaactccagc
gaggacgcaagcgcctgcctgcagctggtgatgtggaaggtccgacagcgcgcccagatc
cagccacgccaccggtccgcctctcccgccgccctggcctgtccttag

DBGET integrated database retrieval system