KEGG   Homo sapiens (human): 254973Help
Entry
254973            CDS       T01001                                 

Gene name
OR1L4, OR1L5, OR9-29, OR9-E, OST046
Definition
(RefSeq) olfactory receptor family 1 subfamily L member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    254973 (OR1L4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    254973 (OR1L4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 254973
NCBI-ProteinID: NP_001005235
HGNC: 8216
Ensembl: ENSG00000136939
Vega: OTTHUMG00000020620
Pharos: Q8NGR5(Tdark)
UniProt: Q8NGR5
Position
9q33.2
AA seq 311 aa AA seqDB search
METKNYSSSTSGFILLGLSSNPKLQKPLFAIFLIMYLLTAVGNVLIILAIYSDPRLHTPM
YFFLSNLSFMDICFTTVIVPKMLVNFLSETKIISYVGCLIQMYFFMAFGNTDSYLLASMA
IDRLVAICNPLHYDVVMKPWHCLLMLLGSCSISHLHSLFRVLLMSRLSFCASHIIKHFFC
DTQPVLKLSCSDTSSSQMVVMTETLAVIVTPFLCTIFSYLQIIVTVLRIPSAAGKWKAFS
TCGSHLTVVVLFYGSVIYVYFRPLSMYSVMKGRVATVMYTVVTPMLNPFIYSLRNKDMKR
GLKKLRHRIYS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagacaaagaattatagcagcagcacctcaggcttcatcctcctgggcctctcttcc
aaccctaagctgcagaaacctctctttgccatcttcctcatcatgtacctactcactgcg
gtggggaatgtgctcatcatcctggccatctactctgaccccaggctccacacccctatg
tacttttttctcagcaacttgtctttcatggatatctgcttcacaacagtcatagtgcct
aagatgctggtgaattttctatcagagacaaagattatctcttatgtgggctgcctgatc
cagatgtacttcttcatggcatttgggaacactgacagctacctgctggcctctatggcc
atcgaccggctggtggccatctgcaaccccttacactatgatgtggttatgaaaccatgg
cattgcctactcatgctattgggttcttgcagcatctcccacctacattccctgttccgc
gtgctacttatgtctcgcttgtctttctgtgcctctcacatcattaagcactttttctgt
gacacccagcctgtgctaaagctctcctgctctgacacatcctccagccagatggtggtg
atgactgagaccttagctgtcattgtgacccccttcctgtgtaccatcttctcctacctg
caaatcatcgtcactgtgctcagaatcccctctgcagccgggaagtggaaggccttctct
acctgtggctcccacctcactgtagtggtcctgttctatgggagtgtcatctatgtctat
tttaggcctctgtccatgtactcagtgatgaagggccgggtagccacagttatgtacaca
gtagtgacacccatgctgaaccctttcatctacagcctgaggaacaaagatatgaaaagg
ggtttgaagaaattaagacacagaatttactcatag

DBGET integrated database retrieval system