KEGG   Homo sapiens (human): 2550Help
Entry
2550              CDS       T01001                                 

Gene name
GABBR1, GABABR1, GABBR1-3, GB1, GPRC3A
Definition
(RefSeq) gamma-aminobutyric acid type B receptor subunit 1
  KO
K04615  
gamma-aminobutyric acid type B receptor
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
GABAergic synapse
Taste transduction
Estrogen signaling pathway
Morphine addiction
Drug target
Aminobutyric acid: 
Arbaclofen (DG01354): 
Baclofen: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    2550 (GABBR1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2550 (GABBR1)
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    2550 (GABBR1)
  Nervous system
   04727 GABAergic synapse
    2550 (GABBR1)
  Sensory system
   04742 Taste transduction
    2550 (GABBR1)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2550 (GABBR1)
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Biogenic amine
   GABA
    2550 (GABBR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.31
AA seq 961 aa AA seqDB search
MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVD
YEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGDLP
ALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTPHSERRAVYIGALFPMSG
GWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKI
ILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKL
FEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDAR
IIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVE
GHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALA
LNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIE
QLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSS
LGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRNQFP
FVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGM
DVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLL
LLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLA
IVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEK
IIAEKEERVSELRHQLQSRQQLRSRRHPPTPPEPSGGLPRGPPEPPDRLSCDGSRVHLLY
K
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgctgctgctactggcgccactcttcctccgccccccgggcgcgggcggggcg
cagacccccaacgccacctcagaaggttgccagatcatacacccgccctgggaagggggc
atcaggtaccggggcctgactcgggaccaggtgaaggctatcaacttcctgccagtggac
tatgagattgagtatgtgtgccggggggagcgcgaggtggtggggcccaaggtccgcaag
tgcctggccaacggctcctggacagatatggacacacccagccgctgtgtccgaatctgc
tccaagtcttatttgaccctggaaaatgggaaggttttcctgacgggtggggacctccca
gctctggacggagcccgggtggatttccggtgtgaccccgacttccatctggtgggcagc
tcccggagcatctgtagtcagggccagtggagcacccccaagccccactgccaggtgaat
cgaacgccacactcagaacggcgcgcagtgtacatcggggcactgtttcccatgagcggg
ggctggccagggggccaggcctgccagcccgcggtggagatggcgctggaggacgtgaat
agccgcagggacatcctgccggactatgagctcaagctcatccaccacgacagcaagtgt
gatccaggccaagccaccaagtacctatatgagctgctctacaacgaccctatcaagatc
atccttatgcctggctgcagctctgtctccacgctggtggctgaggctgctaggatgtgg
aacctcattgtgctttcctatggctccagctcaccagccctgtcaaaccggcagcgtttc
cccactttcttccgaacgcacccatcagccacactccacaaccctacccgcgtgaaactc
tttgaaaagtggggctggaagaagattgctaccatccagcagaccactgaggtcttcact
tcgactctggacgacctggaggaacgagtgaaggaggctggaattgagattactttccgc
cagagtttcttctcagatccagctgtgcccgtcaaaaacctgaagcgccaggatgcccga
atcatcgtgggacttttctatgagactgaagcccggaaagttttttgtgaggtgtacaag
gagcgtctctttgggaagaagtacgtctggttcctcattgggtggtatgctgacaattgg
ttcaagatctacgacccttctatcaactgcacagtggatgagatgactgaggcggtggag
ggccacatcacaactgagattgtcatgctgaatcctgccaatacccgcagcatttccaac
atgacatcccaggaatttgtggagaaactaaccaagcgactgaaaagacaccctgaggag
acaggaggcttccaggaggcaccgctggcctatgatgccatctgggccttggcactggcc
ctgaacaagacatctggaggaggcggccgttctggtgtgcgcctggaggacttcaactac
aacaaccagaccattaccgaccaaatctaccgggcaatgaactcttcgtcctttgagggt
gtctctggccatgtggtgtttgatgccagcggctctcggatggcatggacgcttatcgag
cagcttcagggtggcagctacaagaagattggctactatgacagcaccaaggatgatctt
tcctggtccaaaacagataaatggattggagggtcccccccagctgaccagaccctggtc
atcaagacattccgcttcctgtcacagaaactctttatctccgtctcagttctctccagc
ctgggcattgtcctagctgttgtctgtctgtcctttaacatctacaactcacatgtccgt
tatatccagaactcacagcccaacctgaacaacctgactgctgtgggctgctcactggct
ttagctgctgtcttccccctggggctcgatggttaccacattgggaggaaccagtttcct
ttcgtctgccaggcccgcctctggctcctgggcctgggctttagtctgggctacggttcc
atgttcaccaagatttggtgggtccacacggtcttcacaaagaaggaagaaaagaaggag
tggaggaagactctggaaccctggaagctgtatgccacagtgggcctgctggtgggcatg
gatgtcctcactctcgccatctggcagatcgtggaccctctgcaccggaccattgagaca
tttgccaaggaggaacctaaggaagatattgacgtctctattctgccccagctggagcat
tgcagctccaggaagatgaatacatggcttggcattttctatggttacaaggggctgctg
ctgctgctgggaatcttccttgcttatgagaccaagagtgtgtccactgagaagatcaat
gatcaccgggctgtgggcatggctatctacaatgtggcagtcctgtgcctcatcactgct
cctgtcaccatgattctgtccagccagcaggatgcagcctttgcctttgcctctcttgcc
atagttttctcctcctatatcactcttgttgtgctctttgtgcccaagatgcgcaggctg
atcacccgaggggaatggcagtcggaggcgcaggacaccatgaagacagggtcatcgacc
aacaacaacgaggaggagaagtcccggctgttggagaaggagaaccgtgaactggaaaag
atcattgctgagaaagaggagcgtgtctctgaactgcgccatcaactccagtctcggcag
cagctccgctcccggcgccacccaccgacacccccagaaccctctgggggcctgcccagg
ggaccccctgagccccccgaccggcttagctgtgatgggagtcgagtgcatttgctttat
aagtga

DBGET integrated database retrieval system