KEGG   Homo sapiens (human): 255231Help
Entry
255231            CDS       T01001                                 

Gene name
MCOLN2, TRP-ML2, TRPML2
Definition
(RefSeq) mucolipin 2
  KO
K04993  
mucolipin 2
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPML (Mucolipin)
   255231 (MCOLN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p22
AA seq 566 aa AA seqDB search
MARQPYRFPQARIPERGSGVFRLTVRNAMAHRDSEMKEECLREDLKFYFMSPCEKYRARR
QIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGYSGTDEDDYSCS
VYTQEDAYESIFFAINQYHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETL
NIDNDVELDCVQLDLQDLSKKPPDWKNSSFFRLEFYRLLQVEISFHLKGIDLQTIHSREL
PDCYVFQNTIIFDNKAHSGKIKIYFDSDAKIEECKDLNIFGSTQKNAQYVLVFDAFVIVI
CLASLILCTRSIVLALRLRKRFLNFFLEKYKRPVCDTDQWEFINGWYVLVIISDLMTIIG
SILKMEIKAKNLTNYDLCSIFLGTSTLLVWVGVIRYLGYFQAYNVLILTMQASLPKVLRF
CACAGMIYLGYTFCGWIVLGPYHDKFENLNTVAECLFSLVNGDDMFATFAQIQQKSILVW
LFSRLYLYSFISLFIYMILSLFIALITDSYDTIKKFQQNGFPETDLQEFLKECSSKEEYQ
KESSAFLSCICCRRRKRSDDHLIPIS
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggcccggcagccttatcgttttccccaggcaaggattccggagagaggatcaggtgtt
ttcaggttaaccgtcagaaatgcaatggcacatcgtgattctgagatgaaagaagaatgt
ctaagggaagacctgaagttttacttcatgagcccttgtgaaaaataccgagccagacgc
cagattccgtggaaactgggtttgcagattttgaagatagtcatggtcaccacacagctt
gttcgttttggtttaagtaaccagctggtggttgctttcaaagaagataacactgttgct
tttaagcacttgtttttgaaaggatattctggtacagatgaagatgactacagctgcagt
gtatatactcaagaggatgcctatgagagcatcttttttgctattaatcagtatcatcag
ctaaaggacattaccctggggacccttggttatggagaaaatgaagacaatagaattggc
ttaaaagtctgtaagcagcattacaagaaagggaccatgtttccttctaatgagacactg
aatattgacaacgacgttgagctcgattgtgttcaattagaccttcaggacctctccaag
aagcctccggactggaagaactcatcattcttcagactggaattttatcggctcttacag
gttgaaatctcctttcatcttaaaggcattgacctacagacaattcattcccgtgagtta
ccagactgttatgtctttcagaatacgattatctttgacaataaagctcacagtggcaaa
atcaaaatctattttgacagtgatgccaaaattgaagaatgtaaagacttgaacatattt
ggatctactcagaaaaatgctcagtatgtcctggtgtttgatgcatttgtcattgtgatt
tgcttggcatctcttattctgtgtacaagatccattgttcttgctctaaggttacggaag
agatttctaaatttcttcctggagaagtacaagcggcctgtgtgtgacaccgaccagtgg
gagttcatcaacggctggtatgtcctggtgattatcagcgacctaatgacaatcattggc
tccatattaaaaatggaaatcaaagcaaagaatctcacaaactatgatctctgcagcatt
tttcttggaacctctacgctcttggtttgggttggagtcatcagatacctgggttatttc
caggcatataatgtgctgattttaacaatgcaggcctcactgccaaaagttcttcggttt
tgtgcttgtgctggtatgatttatctgggttacacattctgtggctggattgtcttagga
ccataccatgacaagtttgaaaatctgaacacagttgctgagtgtctgttttctctggtc
aacggtgatgacatgtttgcaacctttgcccaaatccagcagaagagcatcttggtgtgg
ctgttcagtcgtctgtatttatattccttcatcagcctttttatatatatgattctcagt
ctttttattgcacttattacagattcttatgacaccattaagaaattccaacagaatggg
tttcctgaaacggatttgcaggaattcctgaaggaatgcagtagcaaagaagagtatcag
aaagagtcctcagccttcctgtcctgcatctgctgtcggaggaggaaaagaagtgatgat
cacttgatacctattagctaa

DBGET integrated database retrieval system