KEGG   Homo sapiens (human): 255275Help
Entry
255275            CDS       T01001                                 

Gene name
MYADML2
Definition
(RefSeq) myeloid associated differentiation marker like 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
A6NDP7(Tdark)
UniProt: 
Position
17q25.3
AA seq 307 aa AA seqDB search
MGSTMEPPGGAYLHLGAVTSPVGTARVLQLAFGCTTFSLVAHRGGFAGVQGTFCMAAWGF
CFAVSALVVACEFTRLHGCLRLSWGNFTAAFAMLATLLCATAAVLYPLYFARRECSPEPA
GCAARDFRLAASVFAGLLFLAYAVEVALTRARPGQVSSYMATVSGLLKIVQAFVACIIFG
ALVHDSRYGRYVATQWCVAVYSLCFLATVAVVALSVMGHTGGLGCPFDRLVVVYTFLAVL
LYLSAAVIWPVFCFDPKYGEPKRPPNCARGSCPWDSQLVVAIFTYVNLLLYVVDLAYSQR
IRFVPSL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcaccatggagccccctgggggtgcgtacctgcacctgggcgccgtgacatcc
cctgtgggcacagcccgcgtgctgcagctggcctttggctgcactaccttcagcctggtg
gcccaccggggtggctttgcgggcgtccagggcaccttctgcatggccgcctggggcttc
tgcttcgccgtctctgcgctggtggtggcctgtgagttcacacggctccacggctgcctg
cggctctcctggggcaacttcaccgccgccttcgccatgctggccaccctgctatgcgcg
acggctgcggtcctgtatccgctgtactttgcccggcgggagtgttcccccgagcccgcc
ggctgtgctgccagggacttccgcctggcagccagtgtcttcgccgggctcctcttcctg
gcctacgctgtggaggtggccctgacgcgggcccggcccggccaggtgagcagctatatg
gccacggtgtcggggctcctcaagatcgtccaggccttcgtggcctgcatcatcttcggg
gcgctggtccatgacagccgctacgggcgctacgtggccacccagtggtgcgtggccgtc
tacagcctgtgcttcctggccacagtggccgtggtggccctgagtgtgatgggccacaca
gggggcctgggctgcccctttgaccggctggtggtggtgtacaccttcctggctgtgctc
ctgtacctcagcgccgccgtgatctggccagtcttctgtttcgatcccaagtacggtgag
cccaaacggccccccaactgtgctcggggcagctgtccctgggacagccagctggtggtg
gccatcttcacctacgtcaacctgctcctgtacgtcgttgacctcgcctactcccagagg
attcgcttcgtgcccagcctgtag

DBGET integrated database retrieval system