KEGG   Homo sapiens (human): 2555Help
Entry
2555              CDS       T01001                                 

Gene name
GABRA2
Definition
gamma-aminobutyric acid (GABA) A receptor, alpha 2
Orthology
K05175  
gamma-aminobutyric acid receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Retrograde endocannabinoid signaling
GABAergic synapse
Morphine addiction
Nicotine addiction
Drug target
Furosemide: 
Hexobarbital: 
Thiopental: 
Propofol: 
Methylphenobarbital: 
Phenobarbital: 
Clonazepam: 
Aminobutyric acid: 
Diazepam: 
Chlordiazepoxide: 
Medazepam: 
Oxazepam: 
Potassium clorazepate: 
Lorazepam: 
Adinazolam: 
Bromazepam: 
Clobazam: 
Prazepam: 
Alprazolam: 
Nordazepam: 
Fludiazepam: 
Ethyl loflazepate: 
Etizolam: 
Clotiazepam: 
Cloxazolam: 
Tofisopam: 
Meprobamate: 
Pentobarbital: 
Amobarbital: 
Barbital: 
Secobarbital: 
Flurazepam: 
Nitrazepam: 
Flunitrazepam: 
Estazolam: 
Triazolam: 
Lormetazepam: 
Temazepam: 
Midazolam: 
Brotizolam: 
Quazepam: 
Loprazolam: 
Glutethimide: 
Zopiclone: 
Zolpidem: 
Eszopiclone: 
Methaqualone: 
Pentetrazol: 
Flumazenil: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2555 (GABRA2)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    2555 (GABRA2)
   04723 Retrograde endocannabinoid signaling
    2555 (GABRA2)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2555 (GABRA2)
   05033 Nicotine addiction
    2555 (GABRA2)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  GABA-A
   2555 (GABRA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p12
AA seq 451 aa AA seqDB search
MKTKLNIYNMQFLLFVFLVWDPARLVLANIQEDEAKNNITIFTRILDRLLDGYDNRLRPG
LGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSC
PLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVM
TAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASV
MIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFNSVSKIDRM
SRIVFPVLFGTFNLVYWATYLNREPVLGVSP
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaaaattgaacatctacaacatgcagttcctgctttttgttttcttggtgtgg
gaccctgccaggttggtgctggctaacatccaagaagatgaggctaaaaataacattacc
atctttacgagaattcttgacagacttctggatggttacgataatcggcttagaccagga
ctgggagacagtattactgaagtcttcactaacatctacgtgaccagttttggccctgtc
tcagatacagatatggaatatacaattgatgttttctttcgacaaaaatggaaagatgaa
cgtttaaaatttaaaggtcctatgaatatccttcgactaaacaatttaatggctagcaaa
atctggactccagataccttttttcacaatgggaaaaaatcagtagctcataatatgaca
atgccaaataagttgcttcgaattcaggatgatgggactctgctgtataccatgaggctt
acagttcaagctgaatgcccaatgcacttggaggatttcccaatggatgctcattcatgt
cctctgaaatttggcagctatgcatatacaacttcagaggtcacttatatttggacttac
aatgcatctgattcagtacaggttgctcctgatggctctaggttaaatcaatatgacctg
ctgggccaatcaatcggaaaggagacaattaaatccagtacaggtgaatatactgtaatg
acagctcatttccacctgaaaagaaaaattgggtattttgtgattcaaacctatctgcct
tgcatcatgactgtcattctctcccaagtttcattctggcttaacagagaatctgtgcct
gcaagaactgtgtttggagtaacaactgtcctaacaatgacaactctaagcatcagtgct
cggaattctctccccaaagtggcttatgcaactgccatggactggtttattgctgtttgt
tatgcatttgtgttctctgccctaattgaatttgcaactgttaattacttcaccaaaaga
ggatgggcttgggatgggaagagtgtagtaaatgacaagaaaaaagaaaaggcttccgtt
atgatacagaacaacgcttatgcagtggctgttgccaattatgccccgaatctttcaaaa
gatccagttctctccaccatctccaagagtgcaaccacgccagaacccaacaagaagcca
gaaaacaagccagctgaagcaaagaaaactttcaacagtgttagcaaaattgacagaatg
tccagaatagtttttccagttttgtttggtacctttaatttagtttactgggctacatat
ttaaacagagaacctgtattaggggtcagtccttga

DBGET integrated database retrieval system