KEGG   Homo sapiens (human): 2559Help
Entry
2559              CDS       T01001                                 

Gene name
GABRA6
Definition
gamma-aminobutyric acid (GABA) A receptor, alpha 6
Orthology
K05175  
gamma-aminobutyric acid receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Retrograde endocannabinoid signaling
GABAergic synapse
Morphine addiction
Nicotine addiction
Drug target
Furosemide: 
Hexobarbital: 
Thiopental: 
Propofol: 
Methylphenobarbital: 
Phenobarbital: 
Clonazepam: 
Aminobutyric acid: 
Diazepam: 
Chlordiazepoxide: 
Medazepam: 
Oxazepam: 
Potassium clorazepate: 
Lorazepam: 
Adinazolam: 
Bromazepam: 
Clobazam: 
Prazepam: 
Alprazolam: 
Nordazepam: 
Fludiazepam: 
Ethyl loflazepate: 
Etizolam: 
Clotiazepam: 
Cloxazolam: 
Tofisopam: 
Meprobamate: 
Pentobarbital: 
Amobarbital: 
Barbital: 
Secobarbital: 
Flurazepam: 
Nitrazepam: 
Flunitrazepam: 
Estazolam: 
Triazolam: 
Lormetazepam: 
Temazepam: 
Midazolam: 
Brotizolam: 
Quazepam: 
Loprazolam: 
Glutethimide: 
Zopiclone: 
Zolpidem: 
Eszopiclone: 
Methaqualone: 
Pentetrazol: 
Flumazenil: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; GABAergic synapse [PATH:hsa04727]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
Human Diseases; Substance dependence; Nicotine addiction [PATH:hsa05033]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q34
AA seq 453 aa AA seqDB search
MASSLPWLCIILWLENALGKLEVEGNFYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKT
DIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLKFGGPTEILSLNNLMVSKIWTPDTFFRN
GKKSIAHNMTTPNKLFRIMQNGTILYTMRLTINADCPMRLVNFPMDGHACPLKFGSYAYP
KSEIIYTWKKGPLYSVEVPEESSSLLQYDLIGQTVSSETIKSNTGEYVIMTVYFHLQRKM
GYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYA
TAMDWFIAVCFAFVFSALIEFAAVNYFTNLQTQKAKRKAQFAAPPTVTISKATEPLEAEI
VLHPDSKYHLKKRITSLSLPIVSSSEANKVLTRAPILQSTPVTPPPLSPAFGGTSKIDQY
SRILFPVAFAGFNLVYWVVYLSKDTMEVSSSVE
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtctctgccctggctgtgcattattctgtggctagaaaatgccctagggaaa
ctcgaagttgaaggcaacttctactcagaaaacgtcagtcggatcctggacaacttgctt
gaaggctatgacaatcggctgcggccgggatttggaggtgctgtcactgaagtcaaaaca
gacatttatgtgaccagttttgggcccgtgtcagatgtggagatggagtatacgatggat
gtttttttccgccagacctggactgatgagaggttgaagtttggggggccaactgagatt
ctgagtctgaataatttgatggtcagtaaaatctggacgcctgacacctttttcagaaat
ggtaaaaagtccattgctcacaacatgacaactcctaataaactcttcagaataatgcag
aatggaaccattttatacaccatgaggcttaccatcaatgctgactgtcccatgaggctg
gttaactttcctatggatgggcatgcttgtccactcaagtttgggagctatgcttatccc
aaaagtgaaatcatatatacgtggaaaaaaggaccactttactcagtagaagtcccagaa
gaatcttcaagccttctccagtatgatctgattggacaaacagtatctagtgagacaatt
aaatctaacacaggtgaatacgttataatgacagtttacttccacttgcaaaggaagatg
ggctacttcatgatacagatatacactccttgcattatgacagtcattctttcccaggtg
tctttctggattaataaggagtccgtcccagcaagaactgtttttgggatcaccactgtt
ttaactatgaccactttgagcatcagtgcccggcactctttgccaaaagtgtcatatgcc
actgccatggattggttcatagctgtttgctttgcattcgtcttctctgcgcttatcgag
ttcgcagctgtcaactactttaccaatcttcagacacagaaggccaaaaggaaggcacag
tttgcagccccacccacagtgacaatatcaaaagctactgaacctttggaagctgagatt
gttttgcatcctgactccaaatatcatctgaagaaaaggatcacttctctgtctttgcca
atagtttcatcttccgaggccaataaagtgctcacgagagcgcccatcttacaatcaaca
cctgtcacacccccaccactctcgccagcctttggaggcaccagtaaaatagaccagtat
tctcgaattctcttcccagttgcatttgcaggattcaaccttgtgtactgggtagtttat
ctttccaaagatacaatggaagtcagtagcagtgttgaatag

DBGET integrated database retrieval system