KEGG   Homo sapiens (human): 255967Help
Entry
255967            CDS       T01001                                 

Gene name
PAN3
Definition
(RefSeq) PAN3 poly(A) specific ribonuclease subunit
  KO
K12572  
PAB-dependent poly(A)-specific ribonuclease subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    255967 (PAN3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     255967 (PAN3)
  mRNA degradation factors
   3'-5' decay
    Pan complex
     255967 (PAN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q12.2
AA seq 887 aa AA seqDB search
MNSGGGLPPPSAAASPSSSSLAAAVAVVAPPGVGGVPGGAAVGVKLKYCRYYAKDKTCFY
GEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPVAGFPPGAVAGGGAGPPPGPKKPDLG
DPGTGAAAGGGGSSGGLDGPRLAIPGMDGGALTDTSLTDSYFSTSFIGVNGFGSPVETKY
PLMQRMTNSSSSPSLLNDSAKPYSAHDPLTSPASSLFNDFGALNISQRRKPRKYRLGMLE
ERLVPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGST
SRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRR
SHTPNPASYMVPSSASTSVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPN
YHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYH
SLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMW
KKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQH
EGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVG
VFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTIN
YSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRL
FRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLN
KLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtggcggcggcctcccgcccccctcggccgccgcctccccttcctcctcctcg
ctggcggcggcggtggcggtggtggccccgccgggggtcgggggtgtccccggcggggcg
gcggtaggagtgaagctgaagtactgccgctactacgctaaggataagacttgcttctac
ggggaggagtgtcagttcctgcatgaggaccctgccgccggggctgccccgggcctcggc
ctccatagcaacagcgtccccctggctctggctggtgcacccgtggccggctttccgccg
ggagccgtcgcgggcgggggagctgggccgccccccgggcccaagaagccggacctgggg
gacccggggaccggagccgcagccggcggaggaggcagtagcgggggactcgatggaccg
cggctggcaattccaggaatggatggaggtgctttaactgatacaagtctcacagattcc
tattttagcaccagctttattggagtcaatggatttggaagccctgtagaaacaaaatat
cccctgatgcagagaatgactaatagtagcagctccccaagccttctaaatgacagtgcc
aagccatattcagcccatgatcctctaacatcacctgcttcatccttgtttaatgacttt
ggtgccctcaacatctctcagagacgaaagccaaggaagtatcgcctggggatgctggag
gagaggctagttccgatgggatcaaaggcacgaaaagcaaagaaccctattggctgcctt
gctgacaggtgtaaatcaggagtacccatcaatatggtttggtggaacagagtcacagaa
aacaatttacagacaccaaatcctactgcaagcgagtttattcctaaaggaggatcaacc
tccaggctgagtaacgtgtcccagtcaaatatgtctgccttctctcaagttttctctcac
ccatccatgggaagccctgctactgctggattagcgccaggaatgtcgttgtctgctggg
tcttcccctcttcattcccccaagattactccacatacttctcctgctcccagaagaaga
agtcacactccaaatccagcaagttacatggtgccttctagtgcctctacatctgttaat
aatcctgtttctcagactccgtcttctggtcaggtgatccaaaaggaaactgttggtggg
acgacttacttctatacagacacaactccagcacctttgactggaatggtgtttccaaac
tatcatatttatcctccaactgcacctcacgttgcttatatgcaaccgaaagcaaacgca
ccttccttcttcatggctgatgaactccgacaggagctgatcaacagacatttaataaca
atggctcaaattgatcaagcagatatgccagcagttcctacagaggttgacagctaccat
agcctattccctctagaaccactgccacctcccaaccggatacagaaatcaagtaatttt
ggatatattacatcttgctacaaagctgtaaacagcaaagatgatctgccatattgcctt
cggaggatacatggttttcgtcttgttaacacaaagtgcatggtgttggtcgacatgtgg
aagaaaattcaacactcaaatatcgtaactttgcgtgaagtatttaccactaaagcattt
gctgagccctctcttgtgtttgcatatgatttccatgctggaggagaaactatgatgagc
agacactttaatgaccctaatgctgatgcctacttcaccaagagaaagtggggtcagcac
gagggaccattgcccaggcagcatgctggattattgccagaatctcttatttgggcatat
attgtccaactaagttctgcattgcgtaccattcatacagcaggtttggcatgtcgagtt
atggatccaacaaagattctgataactggcaaaacaaggttgcgagtaaattgtgttgga
gtttttgatgttttaacatttgataacagtcaaaataataatccattggcattaatggcc
cagtaccagcaagcagatctgatatcattaggaaaagttgtgttggctttggcttgcaac
tctttggcaggaattcagcgagagaatttacagaaagccatggaactggtgacaatcaac
tattcctctgacctgaagaatctgattttgtatttgttgactgaccaaaacaggatgcga
agtgtaaatgacatcatgcccatgattggtgctcgattttatactcaattggatgctgct
caaatgagaaatgatgtcatagaggaagaccttgcaaaggaggttcaaaatggaagactg
tttaggctcctagcaaaattgggaacaatcaatgagaggccggagtttcagaaggatccc
acttggtcagagactggagaccgttatctgttgaaactctttagggatcatctttttcat
caggtgacagaagcaggtgctccctggattgacctcagtcatataatttcttgtcttaac
aagctagatgctggtgtgccagaaaaaataagcctgatttccagagatgagaagagtgta
cttgtggtgacctacagtgacttaaagcgctgctttgaaaatacttttcaagaactgatt
gcagctgcaaatggtcagttgtag

DBGET integrated database retrieval system