KEGG   Homo sapiens (human): 2562Help
Entry
2562              CDS       T01001                                 

Gene name
GABRB3, ECA5
Definition
gamma-aminobutyric acid (GABA) A receptor, beta 3
Orthology
K05181  
gamma-aminobutyric acid receptor subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Retrograde endocannabinoid signaling
Serotonergic synapse
GABAergic synapse
Morphine addiction
Nicotine addiction
Drug target
Hexobarbital: 
Thiopental: 
Propofol: 
Methylphenobarbital: 
Phenobarbital: 
Clonazepam: 
Aminobutyric acid: 
Diazepam: 
Chlordiazepoxide: 
Medazepam: 
Oxazepam: 
Potassium clorazepate: 
Lorazepam: 
Adinazolam: 
Bromazepam: 
Clobazam: 
Prazepam: 
Alprazolam: 
Nordazepam: 
Fludiazepam: 
Ethyl loflazepate: 
Etizolam: 
Clotiazepam: 
Cloxazolam: 
Tofisopam: 
Meprobamate: 
Pentobarbital: 
Amobarbital: 
Barbital: 
Secobarbital: 
Flurazepam: 
Nitrazepam: 
Flunitrazepam: 
Estazolam: 
Triazolam: 
Lormetazepam: 
Temazepam: 
Midazolam: 
Brotizolam: 
Quazepam: 
Loprazolam: 
Glutethimide: 
Zopiclone: 
Zolpidem: 
Eszopiclone: 
Methaqualone: 
Pentetrazol: 
Flumazenil: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2562 (GABRB3)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    2562 (GABRB3)
   04726 Serotonergic synapse
    2562 (GABRB3)
   04723 Retrograde endocannabinoid signaling
    2562 (GABRB3)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2562 (GABRB3)
   05033 Nicotine addiction
    2562 (GABRB3)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  GABA-A
   2562 (GABRB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q12
AA seq 473 aa AA seqDB search
MWGLAGGRLFGIFSAPVLVAVVCCAQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPP
VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK
RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKI
PYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNR
VDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRS
LPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtggggccttgcgggaggaaggcttttcggcatcttctcggccccggtgctggtggct
gtggtgtgctgcgcccagagtgtgaacgatcccgggaacatgtcctttgtgaaggagacg
gtggacaagctgttgaaaggctacgacattcgcctaagacccgacttcgggggtcccccg
gtctgcgtggggatgaacatcgacatcgccagcatcgacatggtttccgaagtcaacatg
gattataccttaaccatgtattttcaacaatattggagagataaaaggctcgcctattct
gggatccctctcaacctcacgcttgacaatcgagtggctgaccagctatgggtgcccgac
acatatttcttaaatgacaaaaagtcatttgtgcatggagtgacagtgaaaaaccgcatg
atccgtcttcaccctgatgggacagtgctgtatgggctcagaatcaccacgacagcagca
tgcatgatggacctcaggagataccccctggacgagcagaactgcactctggaaattgaa
agctatggctacaccacggatgacattgagttttactggcgaggcggggacaaggctgtt
accggagtggaaaggattgagctcccgcagttctccatcgtggagcaccgtctggtctcg
aggaatgttgtcttcgccacaggtgcctatcctcgactgtcactgagctttcggttgaag
aggaacattggatacttcattcttcagacttatatgccctctatactgataacgattctg
tcgtgggtgtccttctggatcaattatgatgcatctgctgctagagttgccctcgggatc
acaactgtgctgacaatgacaaccatcaacacccaccttcgggagaccttgcccaaaatc
ccctatgtcaaagccattgacatgtaccttatgggctgcttcgtctttgtgttcctggcc
cttctggagtatgcctttgtcaactacattttctttggaagaggccctcaaaggcagaag
aagcttgcagaaaagacagccaaggcaaagaatgaccgttcaaagagcgaaagcaaccgg
gtggatgctcatggaaatattctgttgacatcgctggaagttcacaatgaaatgaatgag
gtctcaggcggcattggcgataccaggaattcagcaatatcctttgacaactcaggaatc
cagtacaggaaacagagcatgcctcgagaagggcatgggcgattcctgggggacagaagc
ctcccgcacaagaagacccatctacggaggaggtcttcacagctcaaaattaaaatacct
gatctaaccgatgtgaatgccatagacagatggtccaggatcgtgtttccattcactttt
tctcttttcaacttagtttactggctgtactatgttaactga

DBGET integrated database retrieval system