KEGG   Homo sapiens (human): 2563Help
Entry
2563              CDS       T01001                                 

Gene name
GABRD, EIG10, EJM7, GEFSP5
Definition
gamma-aminobutyric acid (GABA) A receptor, delta
Orthology
K05184  
gamma-aminobutyric acid receptor subunit delta
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Retrograde endocannabinoid signaling
GABAergic synapse
Morphine addiction
Nicotine addiction
Disease
H00783  
Febrile seizures
Drug target
Hexobarbital: 
Thiopental: 
Propofol: 
Methylphenobarbital: 
Phenobarbital: 
Clonazepam: 
Aminobutyric acid: 
Diazepam: 
Chlordiazepoxide: 
Medazepam: 
Oxazepam: 
Potassium clorazepate: 
Lorazepam: 
Adinazolam: 
Bromazepam: 
Clobazam: 
Prazepam: 
Alprazolam: 
Nordazepam: 
Fludiazepam: 
Ethyl loflazepate: 
Etizolam: 
Clotiazepam: 
Cloxazolam: 
Tofisopam: 
Meprobamate: 
Pentobarbital: 
Amobarbital: 
Barbital: 
Secobarbital: 
Flurazepam: 
Nitrazepam: 
Flunitrazepam: 
Estazolam: 
Triazolam: 
Lormetazepam: 
Temazepam: 
Midazolam: 
Brotizolam: 
Quazepam: 
Loprazolam: 
Glutethimide: 
Zopiclone: 
Zolpidem: 
Eszopiclone: 
Methaqualone: 
Pentetrazol: 
Flumazenil: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2563 (GABRD)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    2563 (GABRD)
   04723 Retrograde endocannabinoid signaling
    2563 (GABRD)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2563 (GABRD)
   05033 Nicotine addiction
    2563 (GABRD)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  GABA-A
   2563 (GABRD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.3
AA seq 452 aa AA seqDB search
MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAGYARNFRPGIG
GPPVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLSYNHTNETLGLDSRFVDKLW
LPDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVACDMDLAKYPMDEQECML
DLESYGYSSEDIVYYWSESQEHIHGLDKLQLAQFTITSYRFTTELMNFKSAGQFPRLSLH
FHLRRNRGVYIIQSYMPSVLLVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSS
LPRASAIKALDVYFWICYVFVFAALVEYAFAHFNADYRKKQKAKVKVSRPRAEMDVRNAI
VLFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSGGQGGIRARLR
PIDADTIDIYARAVFPAAFAAVNVIYWAAYAM
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgcccgcccggctgctggccccgctcctgctcctctgcgcgcagcagctccgc
ggcaccagagcgatgaatgacatcggcgactacgtgggctccaacctggagatctcctgg
ctccccaacctggacgggctgatagccggctacgcccgcaacttccggcctggcatcgga
ggcccccccgtgaatgtggcccttgccctggaggtggccagcatcgaccacatctcagag
gccaacatggagtacaccatgacggtgttcctgcaccagagctggcgggacagcaggctc
tcctacaaccacaccaacgagaccctgggtctggacagccgcttcgtggacaagctgtgg
ctgcccgacaccttcatcgtgaacgccaagtcggcctggttccacgacgtgacggtggag
aacaagctcatccggctgcagcccgacggcgtgatcctgtacagcatccgaatcacctcc
actgtggcctgcgacatggacctggccaaataccccatggacgagcaggagtgcatgctg
gacctggagagctacggttactcatcggaggacatcgtctactactggtcggagagccag
gagcacatccacgggctggacaagctgcagctggcgcagttcaccatcaccagctaccgc
ttcaccacggagctgatgaacttcaagtccgctggccagttcccacggctcagcctgcac
ttccacctgcggaggaaccgcggcgtgtacatcatccaatcctacatgccctccgtcctg
ctggtcgccatgtcctgggtctccttctggatcagccaggcggcggtgcccgccagggtg
tctctaggcatcaccacggtgctgacgatgaccacgctcatggtcagtgcccgctcctcc
ctgccacgggcatcagccatcaaggcactggacgtctacttctggatctgctatgtcttc
gtgtttgccgccctggtggagtacgcctttgctcatttcaacgccgactacaggaagaag
cagaaggccaaggtcaaggtctccaggccgagggcagagatggacgtgaggaacgccatt
gtcctcttctccctctctgctgccggcgtcacgcaggagctggccatctcccgccggcag
cgccgcgtcccggggaacctgatgggctcctacaggtcggtgggggtggagacaggggag
acgaagaaggagggggcagcccgctcaggaggccaggggggcatccgtgcccggctcagg
cccatcgacgcagacaccattgacatttacgcccgcgctgtgttccctgcggcgtttgcg
gccgtcaatgtcatctactgggcggcatacgccatgtga

DBGET integrated database retrieval system