KEGG   Homo sapiens (human): 2563Help
Entry
2563              CDS       T01001                                 

Gene name
GABRD, EIG10, EJM7, GEFSP5
Definition
(RefSeq) gamma-aminobutyric acid type A receptor delta subunit
  KO
K05184  gamma-aminobutyric acid receptor subunit delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Disease
H00783  Febrile seizures
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225
Aminobutyric acid: D00058
Amobarbital (DG00916): D00555 D02252
Barbital: D01740
Bretazenil: D03155
Bromazepam: D01245
Brotizolam: D01744
Chlordiazepoxide (DG00908): D00267 D00693
Clobazam: D01253
Clonazepam: D00280
Clotiazepam: D01328
Cloxazolam: D01268
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293
Estazolam: D00311
Eszopiclone: D02624
Ethyl loflazepate: D01293
Etizolam: D01514
Fludiazepam: D01354
Flumazenil: D00697
Flunitrazepam: D01230
Flurazepam (DG00919): D00329 D00695 D01408
Flutazolam: D01286
Flutoprazepam: D01279
Gaboxadol: D04282
Ganaxolone: D04300
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365
Lormetazepam: D01657
Medazepam (DG00909): D01292 D04882
Meprobamate: D00376
Methaqualone: D00557
Methylphenobarbital: D00700
Mexazolam: D01316
Midazolam (DG00920): D00550 D00696 D05028
Nimetazepam: D01593
Nitrazepam: D00531
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464
Oxazolam: D01278
Pagoclone: D02616
Pentetrazol: D07409
Pentobarbital (DG00915): D00499 D00500 D02253
Phenobarbital (DG00845): D00506 D00701 D08356
Potassium clorazepate (DG01218): D00694 D03562
Prazepam: D00470
Propofol (DG00797): D00549 D04257
Quazepam: D00457
Remimazolam besilate: D10194
Rilmazafone (DG01307): D01564 D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310
Temazepam: D00370
Thiamylal (DG01377): D00713 D06106
Thiopental (DG00790): D00714
Tofisopam: D01254
Topiramate: D00537
Triazolam: D00387
Zolpidem (DG00922): D00706 D08690
Zopiclone: D01372
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2563 (GABRD)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    2563 (GABRD)
   04723 Retrograde endocannabinoid signaling
    2563 (GABRD)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2563 (GABRD)
   05033 Nicotine addiction
    2563 (GABRD)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  GABA-A
   2563 (GABRD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 2563
NCBI-ProteinID: NP_000806
OMIM: 137163
HGNC: 4084
Ensembl: ENSG00000187730
Vega: OTTHUMG00000041064
Pharos: O14764(Tclin)
UniProt: O14764 A8K496
Position
1p36.33
AA seq 452 aa AA seqDB search
MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAGYARNFRPGIG
GPPVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLSYNHTNETLGLDSRFVDKLW
LPDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVACDMDLAKYPMDEQECML
DLESYGYSSEDIVYYWSESQEHIHGLDKLQLAQFTITSYRFTTELMNFKSAGQFPRLSLH
FHLRRNRGVYIIQSYMPSVLLVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSS
LPRASAIKALDVYFWICYVFVFAALVEYAFAHFNADYRKKQKAKVKVSRPRAEMDVRNAI
VLFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSGGQGGIRARLR
PIDADTIDIYARAVFPAAFAAVNVIYWAAYAM
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgcccgcccggctgctggccccgctcctgctcctctgcgcgcagcagctccgc
ggcaccagagcgatgaatgacatcggcgactacgtgggctccaacctggagatctcctgg
ctccccaacctggacgggctgatagccggctacgcccgcaacttccggcctggcatcgga
ggcccccccgtgaatgtggcccttgccctggaggtggccagcatcgaccacatctcagag
gccaacatggagtacaccatgacggtgttcctgcaccagagctggcgggacagcaggctc
tcctacaaccacaccaacgagaccctgggtctggacagccgcttcgtggacaagctgtgg
ctgcccgacaccttcatcgtgaacgccaagtcggcctggttccacgacgtgacggtggag
aacaagctcatccggctgcagcccgacggcgtgatcctgtacagcatccgaatcacctcc
actgtggcctgcgacatggacctggccaaataccccatggacgagcaggagtgcatgctg
gacctggagagctacggttactcatcggaggacatcgtctactactggtcggagagccag
gagcacatccacgggctggacaagctgcagctggcgcagttcaccatcaccagctaccgc
ttcaccacggagctgatgaacttcaagtccgctggccagttcccacggctcagcctgcac
ttccacctgcggaggaaccgcggcgtgtacatcatccaatcctacatgccctccgtcctg
ctggtcgccatgtcctgggtctccttctggatcagccaggcggcggtgcccgccagggtg
tctctaggcatcaccacggtgctgacgatgaccacgctcatggtcagtgcccgctcctcc
ctgccacgggcatcagccatcaaggcactggacgtctacttctggatctgctatgtcttc
gtgtttgccgccctggtggagtacgcctttgctcatttcaacgccgactacaggaagaag
cagaaggccaaggtcaaggtctccaggccgagggcagagatggacgtgaggaacgccatt
gtcctcttctccctctctgctgccggcgtcacgcaggagctggccatctcccgccggcag
cgccgcgtcccggggaacctgatgggctcctacaggtcggtgggggtggagacaggggag
acgaagaaggagggggcagcccgctcaggaggccaggggggcatccgtgcccggctcagg
cccatcgacgcagacaccattgacatttacgcccgcgctgtgttccctgcggcgtttgcg
gccgtcaatgtcatctactgggcggcatacgccatgtga

DBGET integrated database retrieval system