KEGG   Homo sapiens (human): 2564Help
Entry
2564              CDS       T01001                                 

Gene name
GABRE
Definition
gamma-aminobutyric acid (GABA) A receptor, epsilon
Orthology
K05185  
gamma-aminobutyric acid receptor subunit epsilon
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Retrograde endocannabinoid signaling
GABAergic synapse
Morphine addiction
Nicotine addiction
Drug target
Hexobarbital: 
Thiopental: 
Propofol: 
Methylphenobarbital: 
Phenobarbital: 
Clonazepam: 
Aminobutyric acid: 
Diazepam: 
Chlordiazepoxide: 
Medazepam: 
Oxazepam: 
Potassium clorazepate: 
Lorazepam: 
Adinazolam: 
Bromazepam: 
Clobazam: 
Prazepam: 
Alprazolam: 
Nordazepam: 
Fludiazepam: 
Ethyl loflazepate: 
Etizolam: 
Clotiazepam: 
Cloxazolam: 
Tofisopam: 
Meprobamate: 
Pentobarbital: 
Amobarbital: 
Barbital: 
Secobarbital: 
Flurazepam: 
Nitrazepam: 
Flunitrazepam: 
Estazolam: 
Triazolam: 
Lormetazepam: 
Temazepam: 
Midazolam: 
Brotizolam: 
Quazepam: 
Loprazolam: 
Glutethimide: 
Zopiclone: 
Zolpidem: 
Eszopiclone: 
Methaqualone: 
Pentetrazol: 
Flumazenil: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2564 (GABRE)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    2564 (GABRE)
   04723 Retrograde endocannabinoid signaling
    2564 (GABRE)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2564 (GABRE)
   05033 Nicotine addiction
    2564 (GABRE)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  GABA-A
   2564 (GABRE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 506 aa AA seqDB search
MLSKVLPVLLGILLILQSRVEGPQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETE
TGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEISVNSLGPLSILDMEYTIDI
IFSQTWYDERLCYNDTFESLVLNGNVVSQLWIPDTFFRNSKRTHEHEITMPNQMVRIYKD
GKVLYTIRMTIDAGCSLHMLRFPMDSHSCPLSFSSFSYPENEMIYKWENFKLEINEKNSW
KLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYVPSSVTTMLSWVSFW
IKTESAPARTSLGITSVLTMTTLGTFSRKNFPRVSYITALDFYIAICFVFCFCALLEFAV
LNFLIYNQTKAHASPKLRHPRINSRAHARTRARSRACARQHQEAFVCQIVTTEGSDGEER
PSCSAQQPPSPGSPEGPRSLCSKLACCEWCKRFKKYFCMVPDCEGSTWQQGRLCIHVYRL
DNYSRVVFPVTFFFFNVLYWLVCLNL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccaaagttcttccagtcctcctaggcatcttattgatcctccagtcgagggtc
gagggacctcagactgaatcaaagaatgaagcctcttcccgtgatgttgtctatggcccc
cagccccagcctctggaaaatcagctcctctctgaggaaacaaagtcaactgagactgag
actgggagcagagttggcaaactgccagaagcctctcgcatcctgaacactatcctgagt
aattatgaccacaaactgcgccctggcattggagagaagcccactgtggtcactgttgag
atctccgtcaacagccttggtcctctctctatcctagacatggaatacaccattgacatc
atcttctcccagacctggtacgacgaacgcctctgttacaacgacacctttgagtctctt
gttctgaatggcaatgtggtgagccagctatggatcccggacaccttttttaggaattct
aagaggacccacgagcatgagatcaccatgcccaaccagatggtccgcatctacaaggat
ggcaaggtgttgtacacaattaggatgaccattgatgccggatgctcactccacatgctc
agatttccaatggattctcactcttgccctctatctttctctagcttttcctatcctgag
aatgagatgatctacaagtgggaaaatttcaagcttgaaatcaatgagaagaactcctgg
aagctcttccagtttgattttacaggagtgagcaacaaaactgaaataatcacaacccca
gttggtgacttcatggtcatgacgattttcttcaatgtgagcaggcggtttggctatgtt
gcctttcaaaactatgtcccttcttccgtgaccacgatgctctcctgggtttccttttgg
atcaagacagagtctgctccagcccggacctctctagggatcacctctgttctgaccatg
accacgttgggcaccttttctcgtaagaatttcccgcgtgtctcctatatcacagccttg
gatttctatatcgccatctgcttcgtcttctgcttctgcgctctgttggagtttgctgtg
ctcaacttcctgatctacaaccagacaaaagcccatgcttctcctaaactccgccatcct
cgtatcaatagccgtgcccatgcccgtacccgtgcacgttcccgagcctgtgcccgccaa
catcaggaagcttttgtgtgccagattgtcaccactgagggaagtgatggagaggagcgc
ccgtcttgctcagcccagcagccccctagcccaggtagccctgagggtccccgcagcctc
tgctccaagctggcctgctgtgagtggtgcaagcgttttaagaagtacttctgcatggtc
cccgattgtgagggcagtacctggcagcagggccgcctctgcatccatgtctaccgcctg
gataactactcgagagttgttttcccagtgactttcttcttcttcaatgtgctctactgg
cttgtttgccttaacttgtag

DBGET integrated database retrieval system