KEGG   Homo sapiens (human): 2568Help
Entry
2568              CDS       T01001                                 

Gene name
GABRP
Definition
gamma-aminobutyric acid (GABA) A receptor, pi
Orthology
K05189  
gamma-aminobutyric acid receptor subunit pi
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Retrograde endocannabinoid signaling
GABAergic synapse
Morphine addiction
Nicotine addiction
Drug target
Hexobarbital: 
Thiopental: 
Propofol: 
Methylphenobarbital: 
Phenobarbital: 
Clonazepam: 
Aminobutyric acid: 
Diazepam: 
Chlordiazepoxide: 
Medazepam: 
Oxazepam: 
Potassium clorazepate: 
Lorazepam: 
Adinazolam: 
Bromazepam: 
Clobazam: 
Prazepam: 
Alprazolam: 
Nordazepam: 
Fludiazepam: 
Ethyl loflazepate: 
Etizolam: 
Clotiazepam: 
Cloxazolam: 
Tofisopam: 
Meprobamate: 
Pentobarbital: 
Amobarbital: 
Barbital: 
Secobarbital: 
Flurazepam: 
Nitrazepam: 
Flunitrazepam: 
Estazolam: 
Triazolam: 
Lormetazepam: 
Temazepam: 
Midazolam: 
Brotizolam: 
Quazepam: 
Loprazolam: 
Glutethimide: 
Zopiclone: 
Zolpidem: 
Eszopiclone: 
Methaqualone: 
Pentetrazol: 
Flumazenil: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2568 (GABRP)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    2568 (GABRP)
   04723 Retrograde endocannabinoid signaling
    2568 (GABRP)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2568 (GABRP)
   05033 Nicotine addiction
    2568 (GABRP)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  GABA-A
   2568 (GABRP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.1
AA seq 440 aa AA seqDB search
MNYSLHLAFVCLSLFTERMCIQGSQFNVEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEP
VQIALTLDIASISSISESNMDYTATIYLRQRWMDQRLVFEGNKSFTLDARLVEFLWVPDT
YIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVACNMDLSKYPMDTQTCKLQLES
WGYDGNDVEFTWLRGNDSVRGLEHLRLAQYTIERYFTLVTRSQQETGNYTRLVLQFELRR
NVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVTTVLSMTTLMIGSRTSLPNTN
CFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAAKDRGTTKEVEEVSITNIINSSIS
SFKRKISFASIEISSDNVDYSDLTMKTSDKFKFVFREKMGRIVDYFTIQNPSNVDHYSKL
LFPLIFMLANVFYWAYYMYF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaactacagcctccacttggccttcgtgtgtctgagtctcttcactgagaggatgtgc
atccaggggagtcagttcaacgtcgaggtcggcagaagtgacaagctttccctgcctggc
tttgagaacctcacagcaggatataacaaatttctcaggcccaattttggtggagaaccc
gtacagatagcgctgactctggacattgcaagtatctctagcatttcagagagtaacatg
gactacacagccaccatatacctccgacagcgctggatggaccagcggctggtgtttgaa
ggcaacaagagcttcactctggatgcccgcctcgtggagttcctctgggtgccagatact
tacattgtggagtccaagaagtccttcctccatgaagtcactgtgggaaacaggctcatc
cgcctcttctccaatggcacggtcctgtatgccctcagaatcacgacaactgttgcatgt
aacatggatctgtctaaataccccatggacacacagacatgcaagttgcagctggaaagc
tggggctatgatggaaatgatgtggagttcacctggctgagagggaacgactctgtgcgt
ggactggaacacctgcggcttgctcagtacaccatagagcggtatttcaccttagtcacc
agatcgcagcaggagacaggaaattacactagattggtcttacagtttgagcttcggagg
aatgttctgtatttcattttggaaacctacgttccttccactttcctggtggtgttgtcc
tgggtttcattttggatctctctcgattcagtccctgcaagaacctgcattggagtgacg
accgtgttatcaatgaccacactgatgatcgggtcccgcacttctcttcccaacaccaac
tgcttcatcaaggccatcgatgtgtacctggggatctgctttagctttgtgtttggggcc
ttgctagaatatgcagttgctcactacagttccttacagcagatggcagccaaagatagg
gggacaacaaaggaagtagaagaagtcagtattactaatatcatcaacagctccatctcc
agctttaaacggaagatcagctttgccagcattgaaatttccagcgacaacgttgactac
agtgacttgacaatgaaaaccagcgacaagttcaagtttgtcttccgagaaaagatgggc
aggattgttgattatttcacaattcaaaaccccagtaatgttgatcactattccaaacta
ctgtttcctttgatttttatgctagccaatgtattttactgggcatactacatgtatttt
tga

DBGET integrated database retrieval system