KEGG   Homo sapiens (human): 2569Help
Entry
2569              CDS       T01001                                 

Gene name
GABRR1
Definition
(RefSeq) gamma-aminobutyric acid type A receptor rho1 subunit
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2569 (GABRR1)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    2569 (GABRR1)
   04723 Retrograde endocannabinoid signaling
    2569 (GABRR1)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2569 (GABRR1)
   05033 Nicotine addiction
    2569 (GABRR1)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  GABA-A
   2569 (GABRR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 2569
NCBI-ProteinID: NP_002033
OMIM: 137161
HGNC: 4090
Ensembl: ENSG00000146276
Vega: OTTHUMG00000015195
Pharos: P24046(Tchem)
UniProt: P24046
Position
6q15
AA seq 479 aa AA seqDB search
MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVHEDAHKQVSPI
LRRSPDITKSPLTKSEQLLRIDDHDFSMRPGFGGPAIPVGVDVQVESLDSISEVDMDFTM
TLYLRHYWKDERLSFPSTNNLSMTFDGRLVKKIWVPDMFFVHSKRSFIHDTTTDNVMLRV
QPDGKVLYSLRVTVTAMCNMDFSRFPLDTQTCSLEIESYAYTEDDLMLYWKKGNDSLKTD
ERISLSQFLIQEFHTTTKLAFYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSW
VSFWIDRRAVPARVPLGITTVLTMSTIITGVNASMPRVSYIKAVDIYLWVSFVFVFLSVL
EYAAVNYLTTVQERKEQKLREKLPCTSGLPPPRTAMLDGNYSDGEVNDLDNYMPENGEKP
DRMMVQLTLASERSSPQRKSQRSSYVSMRIDTHAIDKYSRIIFPAAYILFNLIYWSIFS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgttggctgtcccaaatatgagatttggcatctttcttttgtggtggggatgggttttg
gccactgaaagcagaatgcactggcccggaagagaagtccacgagatgtctaagaaaggc
aggccccaaagacaaagacgagaagtacatgaagatgcccacaagcaagtcagcccaatt
ctgagacgaagtcctgacatcaccaaatcgcctctgacaaagtcagaacagcttctgagg
atagatgaccatgatttcagcatgaggcctggctttggaggccctgccattcctgttggt
gtggatgtgcaggtggagagtttggatagcatctcagaggttgacatggactttacgatg
accctctacctgaggcactactggaaggacgagaggctgtcttttccaagcaccaacaac
ctcagcatgacgtttgacggccggctggtcaagaagatctgggtccctgacatgtttttc
gtgcactccaaacgctccttcatccacgacaccaccacagacaacgtcatgttgcgggtc
cagcctgatgggaaagtgctctatagtctcagggttacagtaactgcaatgtgcaacatg
gacttcagccgatttcccttggacacacaaacgtgctctcttgaaattgaaagctatgcc
tatacagaagatgacctcatgctgtactggaaaaagggcaatgactccttaaagacagat
gaacggatctcactctcccagttcctcattcaggaattccacaccaccaccaaactggct
ttctacagcagcacaggctggtacaaccgtctctacattaatttcacgttgcgtcgccac
atcttcttcttcttgctccaaacttatttccccgctaccctgatggtcatgctgtcctgg
gtgtccttctggatcgaccgcagagccgtgcctgccagagtccccttaggtatcacaacg
gtgctgaccatgtccaccatcatcacgggcgtgaatgcctccatgccgcgcgtctcctac
atcaaggccgtggacatctacctctgggtcagctttgtgttcgtgttcctctcggtgctg
gagtatgcggccgtcaactacctgaccactgtgcaggagaggaaggaacagaagctgcgg
gagaagcttccctgcaccagcggattacctccgccccgcactgcgatgctggacggcaac
tacagtgatggggaggtgaatgacctggacaactacatgccagagaatggagagaagccc
gacaggatgatggtgcagctgaccctggcctcagagaggagctccccacagaggaaaagt
cagagaagcagctatgtgagcatgagaatcgacacccacgccattgataaatactccagg
atcatctttccagcagcatacattttattcaatttaatatactggtctattttctcctag

DBGET integrated database retrieval system