KEGG   Homo sapiens (human): 2570Help
Entry
2570              CDS       T01001                                 

Gene name
GABRR2
Definition
gamma-aminobutyric acid (GABA) A receptor, rho 2
Orthology
K05190  
gamma-aminobutyric acid receptor subunit rho
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Retrograde endocannabinoid signaling
GABAergic synapse
Morphine addiction
Nicotine addiction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; GABAergic synapse [PATH:hsa04727]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
Human Diseases; Substance dependence; Nicotine addiction [PATH:hsa05033]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q15
AA seq 465 aa AA seqDB search
MPYFTRLILFLFCLMVLVESRKPKRKRWTGQVEMPKPSHLYKKNLDVTKIRKGKPQQLLR
VDEHDFSMRPAFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLAFSSASN
KSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLYSMRITVTAMCNM
DFSHFPLDSQTCSLELESYAYTDEDLMLYWKNGDESLKTDEKISLSQFLIQKFHTTSRLA
FYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVSLGITT
VLTMTTIITGVNASMPRVSYVKAVDIYLWVSFVFVFLSVLEYAAVNYLTTVQERKERKLR
EKFPCMCGMLHSKTMMLDGSYSESEANSLAGYPRSHILTEEERQDKIVVHLGLSGEANAA
RKKGLLKGQTGFRIFQNTHAIDKYSRLIFPASYIFFNLIYWSVFS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgccttattttacaagactcattttgttcttgttttgcttgatggttctcgtggagagc
agaaaacccaagaggaagcgatggacagggcaggtggaaatgcccaagccaagtcactta
tataagaagaaccttgatgtgaccaagatccggaagggaaagcctcagcagcttctcaga
gtggacgagcacgacttcagcatgagacccgccttcggaggccctgccatcccggtgggc
gtggacgtacaggtggagagcctggacagcatctccgaggtggacatggacttcactatg
accctgtacctgcggcattactggaaggatgagaggctagctttctccagcgccagcaac
aagagcatgaccttcgatggccggctggtgaagaagatctgggtccctgatgtcttcttt
gttcactccaaaagatcgttcactcatgacaccaccactgacaacatcatgctgagggtg
ttcccagatggacacgtgctgtacagcatgaggattacggtcactgccatgtgcaacatg
gacttcagccactttcccctggactcccagacctgttctttggagctggagagctatgcc
tatacagatgaagatctaatgctgtactggaagaatggggatgaatccctaaaaacagat
gagaagatctccttgtctcagtttctgattcagaaatttcacacaacttccaggctggcc
ttctacagcagcactggctggtacaaccgtctgtacattaacttcacgttgcgtcgccac
atcttcttcttcttgctccaaacatatttccctgccactctgatggtcatgctgtcctgg
gtgtccttctggatcgaccgcagagctgtgcctgccagagtttcactgggtatcacgacg
gtgctgaccatgaccaccatcatcacgggcgtgaatgcctccatgccgcgcgtctcctac
gtcaaggccgtggacatctacctctgggtcagctttgtgttcgtgttcctctcggtgctg
gagtatgcggctgtcaactacctgaccaccgtgcaggagcgcaaggaacggaagctgcgg
gagaagttcccgtgcatgtgtggaatgcttcattcaaaaaccatgatgctggatggaagc
tacagtgagtctgaggccaacagcctggctgggtaccccagaagccatatcctgacagaa
gaagaaaggcaagacaaaatagtggtccacctgggcctgagtggtgaagccaacgctgcc
agaaagaaggggcttctgaagggccagacgggttttcgtatcttccagaatacccatgcc
attgacaaatactctaggttgatattccctgcctcctacatatttttcaacttaatttat
tggtcagtgttttcctag

DBGET integrated database retrieval system