KEGG   Homo sapiens (human): 257194Help
Entry
257194            CDS       T01001                                 

Gene name
NEGR1, DMML2433, IGLON4, KILON, Ntra
Definition
(RefSeq) neuronal growth regulator 1
  KO
K06775  neuronal growth regulator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    257194 (NEGR1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   N/0 subfamily
    OPCML, OBCAM; opioid binding protein/cell adhesion molecule-like [KO:K06773]
     257194 (NEGR1)
    NEGR1; neuronal growth regulator 1 [KO:K06775]
     257194 (NEGR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set Izumo-Ig Ig_5 Ig_4 C2-set_2 V-set_CD47 Adeno_E3_CR1
Motif
Other DBs
NCBI-GeneID: 257194
NCBI-ProteinID: NP_776169
OMIM: 613173
HGNC: 17302
Ensembl: ENSG00000172260
Vega: OTTHUMG00000009698
Pharos: Q7Z3B1(Tbio)
UniProt: Q7Z3B1
Position
1p31.1
AA seq 354 aa AA seqDB search
MDMMLLVQGACCSNQWLAAVLLSLCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRC
YLEDGASKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV
QTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAK
PFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRS
GLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAA
NKLGTTNASLPLNPPSTAQYGITGSADVLFSCWYLVLTLSSFTSIFYLKNAILQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacatgatgctgttggtgcagggtgcttgttgctcgaaccagtggctggcggcggtg
ctcctcagcctgtgctgcctgctaccctcctgcctcccggctggacagagtgtggacttc
ccctgggcggccgtggacaacatgatggtcagaaaaggggacacggcggtgcttaggtgt
tatttggaagatggagcttcaaagggtgcctggctgaaccggtcaagtattatttttgcg
ggaggtgataagtggtcagtggatcctcgagtttcaatttcaacattgaataaaagggac
tacagcctccagatacagaatgtagatgtgacagatgatggcccatacacgtgttctgtt
cagactcaacatacacccagaacaatgcaggtgcatctaactgtgcaagttcctcctaag
atatatgacatctcaaatgatatgaccgtcaatgaaggaaccaacgtcactcttacttgt
ttggccactgggaaaccagagccttccatttcttggcgacacatctccccatcagcaaaa
ccatttgaaaatggacaatatttggacatttatggaattacaagggaccaggctggggaa
tatgaatgcagtgcggaaaatgatgtgtcattcccagatgtgaggaaagtaaaagttgtt
gtcaactttgctcctactattcaggaaattaaatctggcaccgtgacccccggacgcagt
ggcctgataagatgtgaaggtgcaggtgtgccgcctccagcctttgaatggtacaaagga
gagaagaagctcttcaatggccaacaaggaattattattcaaaattttagcacaagatcc
attctcactgttaccaacgtgacacaggagcacttcggcaattatacctgtgtggctgcc
aacaagctaggcacaaccaatgcgagcctgcctcttaaccctccaagtacagcccagtat
ggaattaccgggagcgctgatgttcttttctcctgctggtaccttgtgttgacactgtcc
tctttcaccagcatattctacctgaagaatgccattctacaataa

DBGET integrated database retrieval system