KEGG   Homo sapiens (human): 257397Help
Entry
257397            CDS       T01001                                 

Gene name
TAB3, MAP3K7IP3, NAP1
Definition
TGF-beta activated kinase 1/MAP3K7 binding protein 3
Orthology
K12793  
TAK1-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
NOD-like receptor signaling pathway
TNF signaling pathway
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp21.2
AA seq 712 aa AA seqDB search
MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHS
PDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICL
VQEPHSAPAVVAATPNYNPFFMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPP
PPSYMHIPRYSTNPITVTVSQNLPSGQTVPRALQILPQIPSNLYGSPGSIYIRQTSQSSS
GRQTPQSTPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSAYHSPPPSQC
PSPFSSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPPSYQKQGSHSVAYLPYTASSLSK
GSMKKIEITVEPSQRPGTAINRSPSPISNQPSPWNQHSLYTATTPPSSSPSRGISSQPKP
PFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAP
EPIQPISVIPGSGGEKGSHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLEKEEL
ERLKSEVNGMEHDLMQRRLRRVSCTTAIPTPEEMTRLRSMNRQLQINVDCTLKEVDLLQS
RGNFDPKAMNNFYDNIEPGPVVPPKPSKKDSSDPCTIERKARRISVTSKVQADIHDTQAA
AADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaagcagcccacagcttgatattcaggttctccatgatcttcgacaacgtttc
cctgaaattccagagggcgtggtgtctcagtgcatgttacagaataacaacaatcttgaa
gcctgttgccgagccctttcccaggagagtagcaaatacttatatatggaataccatagt
ccagatgacaataggatgaatagaaatcgccttttacatattaacctgggtatccattct
cctagtagctatcacccaggagatggagcccaacttaatggtggtcgaacactggtacat
agctcaagtgatggacatattgatcctcagcatgcagcaggtaaacagctgatatgttta
gttcaagaaccacactcagctccagctgttgttgctgctactcccaactacaatccattt
tttatgaacgaacagaacagaagtgcagctactcctccttcacaaccacctcaacagcca
tcttccatgcaaacaggaatgaatccgtctgctatgcaagggccttcaccaccaccgcca
cctccttcatacatgcacatacctcggtatagtacaaatccaattactgttacagtatcc
cagaacctcccttctggacagactgtaccaagagctttacaaattcttccacaaattcca
agcaatctctatgggtctcctggttctatttatattagacagacatctcagagttcatca
ggaagacaaactcctcagagtacgccgtggcagtcctcaccacagggcccagtgcctcac
tatagccagcgtcctttacctgtttatccacaccaacagaactatcagccttctcagtat
tctcccaaacagcagcagatccctcagtctgcttaccattcaccacctccttctcaatgt
ccttcacccttcagctctccacagcatcaagtgcaaccttcccagttgggccacatcttt
atgccacctagtccttcaactactccaccccatccatatcaacaaggacctcctagctat
cagaaacagggaagccattcagtagcctatcttccatacacagcatctagtttatccaaa
ggttccatgaagaagatagaaattacagttgaaccttctcaaagacctgggacagcaatt
aataggagtccttcacccatcagtaatcaaccatctccatggaatcaacactcactgtac
acagccaccacgccaccttcaagttctccttcaagagggatatctagtcaaccaaaacct
ccatttagtgttaatcctgtgtatattacatatacacagccaactggaccttcttgtact
ccatcaccatctcctcgagtgataccaaacccaactacagtttttaaaattaccgtaggc
cgagcaacgactgaaaatcttttaaatttagtggaccaagaagagcgctctgcagcacca
gaacctattcagcccatttcagtgataccaggctctgggggagaaaagggaagccataaa
tatcagagaagttctagttctggatcagatgactatgcctacacacaagccttgctgtta
catcaacgagcaaggatggagaggttagcaaagcaactgaaacttgagaaagaggagcta
gagcggttgaagtctgaagttaatggtatggagcatgacctgatgcagagacggctcaga
agagtcagctgcaccactgcgatccctacgcctgaggaaatgacaagattgagaagcatg
aacagacaactccagataaatgttgactgtacactgaaagaagttgacctccttcaatct
agaggaaactttgatccaaaagccatgaataatttttatgacaacatagaacctggccca
gttgtaccacccaagccatctaaaaaagactcctcagacccctgcacaattgagagaaaa
gcccgaagaattagcgtgacctccaaagtacaggcagacatccatgacacccaggcagca
gctgcagatgagcatcgaactggctccacacaaagtcctcggacacaacctcgagatgaa
gactacgaaggggctccatggaattgtgatagctgcacctttcttaaccacccagcacta
aatcgctgtgagcagtgcgagatgccacggtacacctga

DBGET integrated database retrieval system