KEGG   Homo sapiens (human): 25759Help
Entry
25759             CDS       T01001                                 

Gene name
SHC2, SCK, SHCB, SLI
Definition
SHC (Src homology 2 domain containing) transforming protein 2
Orthology
K17447  
SHC- transforming protein 2
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Chemokine signaling pathway
VEGF signaling pathway
Focal adhesion
Natural killer cell mediated cytotoxicity
Neurotrophin signaling pathway
Insulin signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Alcoholism
Bacterial invasion of epithelial cells
Glioma
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    25759 (SHC2)
   04012 ErbB signaling pathway
    25759 (SHC2)
   04370 VEGF signaling pathway
    25759 (SHC2)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    25759 (SHC2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    25759 (SHC2)
   04062 Chemokine signaling pathway
    25759 (SHC2)
  Endocrine system
   04910 Insulin signaling pathway
    25759 (SHC2)
   04915 Estrogen signaling pathway
    25759 (SHC2)
   04917 Prolactin signaling pathway
    25759 (SHC2)
  Nervous system
   04722 Neurotrophin signaling pathway
    25759 (SHC2)
 Human Diseases
  Cancers
   05214 Glioma
    25759 (SHC2)
   05220 Chronic myeloid leukemia
    25759 (SHC2)
  Substance dependence
   05034 Alcoholism
    25759 (SHC2)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    25759 (SHC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 582 aa AA seqDB search
MTQGPGGRAPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPGGFLGRGPAAARAAGASGGA
DPQPEPAGPGGVPALAAAVLGACEPRCAAPCPLPALSRCRGAGSRGSRGGRGAAGSGDAA
AAAEWIRKGSFIHKPAHGWLHPDARVLGPGVSYVVRYMGCIEVLRSMRSLDFNTRTQVTR
EAINRLHEAVPGVRGSWKKKAPNKALASVLGKSNLRFAGMSISIHISTDGLSLSVPATRQ
VIANHHMPSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSIISTVGQAFEL
RFKQYLHSPPKVALPPERLAGPEESAWGDEEDSLEHNYYNSIPGKEPPLGGLVDSRLALT
QPCALTALDQGPSPSLRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGL
DAPEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTAAPLPLEDQWPSPPTRRAPVAPTEE
QLRQEPWYHGRMSRRAAERMLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGV
VRTKDVLFESISHLIDHHLQNGQPIVAAESELHLRGVVSREP
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagggtccgggcgggcgcgcgcccccggcgccccccgcgccccccgagcccgag
gcgcccaccaccttctgcgcgttgctgccccgaatgccgcagtggaagttcgcggccccg
ggcggcttcctgggccgcggcccggcggcggcgcgggcggctggggcctcggggggcgcg
gacccccaacccgagccggcgggcccggggggcgtcccggcgctggcggccgccgtcctg
ggcgcctgcgagccccgctgcgccgcgccctgtcccctgcccgcgctcagccgctgtcgg
ggcgcggggtcgcgggggtcgcggggcgggcggggggcggcggggtccggggacgccgcc
gccgccgccgagtggatccggaagggcagcttcatccacaaacccgcgcacggctggcta
caccccgacgccagggtcctggggcccggggtctcctacgtcgtgcggtacatgggctgc
atcgaggttctccgctctatgcgctccctggactttaacacgcgcacgcaggtgaccagg
gaagccatcaaccggctccatgaggccgtgcctggcgtccggggatcctggaagaaaaag
gcccccaacaaggccctggcgtccgtcctgggcaagagcaaccttcgctttgccggcatg
agcatctccatccacatctccactgatggcctcagcctctccgtgcctgccacgcgccag
gtcatcgccaaccaccacatgccgtccatctccttcgcgtcaggcggagacacggacatg
acggattacgtggcctacgtcgccaaggaccccatcaaccagagagcctgccacatcctg
gagtgctgtgagggcctggcacagagcatcatcagcaccgtgggccaagctttcgagctg
cgcttcaagcagtacctgcacagcccgcccaaggtggcgctgcccccagaaaggctggca
gggccggaggagtcggcctggggggacgaggaggactctttggagcacaattactacaac
agcatcccggggaaggagccgccgctgggcgggctagtggactccaggctggccctgaca
cagccctgcgccctcacggccctcgaccagggcccatctccttctctaagagatgcctgc
agcctgccatgggacgtggggtccaccggtacagctccaccgggggacggctacgtgcag
gcggacgcccggggccccccggaccacgaggagcacctgtatgtcaacacccagggtctg
gacgcccccgagccggaggacagccccaaaaaggatctgtttgacatgcgaccctttgag
gatgccctgaagttgcatgagtgctcagtggcggcaggcgtgacagcagcccctcttccc
ttggaggaccagtggcccagcccccctacccgccgggcccctgtggcccccacggaggaa
cagctgcgtcaggagccctggtaccacggccggatgagccgccgggcggcagagaggatg
cttcgagctgacggggacttccttgtgcgagacagcgtcaccaaccccgggcagtatgtc
ctcaccggcatgcacgccgggcagcccaagcacctgctgctcgtggaccccgagggcgtg
gtacggacgaaggacgtgctgtttgagagcatcagccacctgatcgaccaccacctgcag
aacgggcagcccatcgtggccgccgagagtgagctgcacctgcgtggcgtggtctcacgg
gagccctga

DBGET integrated database retrieval system