KEGG   Homo sapiens (human): 25759Help
Entry
25759             CDS       T01001                                 

Gene name
SHC2, SCK, SHCB, SLI
Definition
(RefSeq) SHC adaptor protein 2
  KO
K17447  SHC-transforming protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04650  Natural killer cell mediated cytotoxicity
hsa04722  Neurotrophin signaling pathway
hsa04910  Insulin signaling pathway
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa05034  Alcoholism
hsa05100  Bacterial invasion of epithelial cells
hsa05214  Glioma
hsa05220  Chronic myeloid leukemia
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    25759 (SHC2)
   04012 ErbB signaling pathway
    25759 (SHC2)
   04370 VEGF signaling pathway
    25759 (SHC2)
   04072 Phospholipase D signaling pathway
    25759 (SHC2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    25759 (SHC2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    25759 (SHC2)
   04062 Chemokine signaling pathway
    25759 (SHC2)
  Endocrine system
   04910 Insulin signaling pathway
    25759 (SHC2)
   04915 Estrogen signaling pathway
    25759 (SHC2)
   04917 Prolactin signaling pathway
    25759 (SHC2)
   04926 Relaxin signaling pathway
    25759 (SHC2)
  Nervous system
   04722 Neurotrophin signaling pathway
    25759 (SHC2)
 Human Diseases
  Cancers
   05225 Hepatocellular carcinoma
    25759 (SHC2)
   05226 Gastric cancer
    25759 (SHC2)
   05214 Glioma
    25759 (SHC2)
   05220 Chronic myeloid leukemia
    25759 (SHC2)
   05224 Breast cancer
    25759 (SHC2)
  Substance dependence
   05034 Alcoholism
    25759 (SHC2)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    25759 (SHC2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    25759 (SHC2)
   01522 Endocrine resistance
    25759 (SHC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH2
Motif
Other DBs
NCBI-GeneID: 25759
NCBI-ProteinID: NP_036567
OMIM: 605217
HGNC: 29869
Ensembl: ENSG00000129946
Vega: OTTHUMG00000180545
Pharos: P98077(Tbio)
UniProt: P98077
Position
19p13.3
AA seq 582 aa AA seqDB search
MTQGPGGRAPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPGGFLGRGPAAARAAGASGGA
DPQPEPAGPGGVPALAAAVLGACEPRCAAPCPLPALSRCRGAGSRGSRGGRGAAGSGDAA
AAAEWIRKGSFIHKPAHGWLHPDARVLGPGVSYVVRYMGCIEVLRSMRSLDFNTRTQVTR
EAINRLHEAVPGVRGSWKKKAPNKALASVLGKSNLRFAGMSISIHISTDGLSLSVPATRQ
VIANHHMPSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSIISTVGQAFEL
RFKQYLHSPPKVALPPERLAGPEESAWGDEEDSLEHNYYNSIPGKEPPLGGLVDSRLALT
QPCALTALDQGPSPSLRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGL
DAPEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTAAPLPLEDQWPSPPTRRAPVAPTEE
QLRQEPWYHGRMSRRAAERMLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGV
VRTKDVLFESISHLIDHHLQNGQPIVAAESELHLRGVVSREP
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagggtccgggcgggcgcgcgcccccggcgccccccgcgccccccgagcccgag
gcgcccaccaccttctgcgcgttgctgccccgaatgccgcagtggaagttcgcggccccg
ggcggcttcctgggccgcggcccggcggcggcgcgggcggctggggcctcggggggcgcg
gacccccaacccgagccggcgggcccggggggcgtcccggcgctggcggccgccgtcctg
ggcgcctgcgagccccgctgcgccgcgccctgtcccctgcccgcgctcagccgctgtcgg
ggcgcggggtcgcgggggtcgcggggcgggcggggggcggcggggtccggggacgccgcc
gccgccgccgagtggatccggaagggcagcttcatccacaaacccgcgcacggctggcta
caccccgacgccagggtcctggggcccggggtctcctacgtcgtgcggtacatgggctgc
atcgaggttctccgctctatgcgctccctggactttaacacgcgcacgcaggtgaccagg
gaagccatcaaccggctccatgaggccgtgcctggcgtccggggatcctggaagaaaaag
gcccccaacaaggccctggcgtccgtcctgggcaagagcaaccttcgctttgccggcatg
agcatctccatccacatctccactgatggcctcagcctctccgtgcctgccacgcgccag
gtcatcgccaaccaccacatgccgtccatctccttcgcgtcaggcggagacacggacatg
acggattacgtggcctacgtcgccaaggaccccatcaaccagagagcctgccacatcctg
gagtgctgtgagggcctggcacagagcatcatcagcaccgtgggccaagctttcgagctg
cgcttcaagcagtacctgcacagcccgcccaaggtggcgctgcccccagaaaggctggca
gggccggaggagtcggcctggggggacgaggaggactctttggagcacaattactacaac
agcatcccggggaaggagccgccgctgggcgggctagtggactccaggctggccctgaca
cagccctgcgccctcacggccctcgaccagggcccatctccttctctaagagatgcctgc
agcctgccatgggacgtggggtccaccggtacagctccaccgggggacggctacgtgcag
gcggacgcccggggccccccggaccacgaggagcacctgtatgtcaacacccagggtctg
gacgcccccgagccggaggacagccccaaaaaggatctgtttgacatgcgaccctttgag
gatgccctgaagttgcatgagtgctcagtggcggcaggcgtgacagcagcccctcttccc
ttggaggaccagtggcccagcccccctacccgccgggcccctgtggcccccacggaggaa
cagctgcgtcaggagccctggtaccacggccggatgagccgccgggcggcagagaggatg
cttcgagctgacggggacttccttgtgcgagacagcgtcaccaaccccgggcagtatgtc
ctcaccggcatgcacgccgggcagcccaagcacctgctgctcgtggaccccgagggcgtg
gtacggacgaaggacgtgctgtttgagagcatcagccacctgatcgaccaccacctgcag
aacgggcagcccatcgtggccgccgagagtgagctgcacctgcgtggcgtggtctcacgg
gagccctga

DBGET integrated database retrieval system