KEGG   Homo sapiens (human): 25766Help
Entry
25766             CDS       T01001                                 

Gene name
PRPF40B, HYPC
Definition
(RefSeq) pre-mRNA processing factor 40 homolog B
  KO
K12821  
pre-mRNA-processing factor 40
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    25766 (PRPF40B)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    25766 (PRPF40B)
 Complex B
    25766 (PRPF40B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q6NWY9(Tdark)
UniProt: 
Position
12q13.12
AA seq 858 aa AA seqDB search
MPPPGIPPPFPPMGLPPMSQRPPAIPPMPPGILPPMLPPMGAPPPLTQIPGMVPPMMPGM
LMPAVPVTAATAPGADTASSAVAGTGPPRALWSEHVAPDGRIYYYNADDKQSVWEKPSVL
KSKAELLLSQCPWKEYKSDTGKPYYYNNQSKESRWTRPKDLDDLEVLVKQEAAGKQQQQL
PQTLQPQPPQPQPDPPPVPPGPTPVPTGLLEPEPGGSEDCDVLEATQPLEQGFLQQLEEG
PSSSGQHQPQQEEEESKPEPERSGLSWSNREKAKQAFKELLRDKAVPSNASWEQAMKMVV
TDPRYSALPKLSEKKQAFNAYKAQREKEEKEEARLRAKEAKQTLQHFLEQHERMTSTTRY
RRAEQTFGELEVWAVVPERDRKEVYDDVLFFLAKKEKEQAKQLRRRNIQALKSILDGMSS
VNFQTTWSQAQQYLMDNPSFAQDHQLQNMDKEDALICFEEHIRALEREEEEERERARLRE
RRQQRKNREAFQTFLDELHETGQLHSMSTWMELYPAVSTDVRFANMLGQPGSTPLDLFKF
YVEELKARFHDEKKIIKDILKVNTAFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEA
REREREKEEARRMRRREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERI
RLFREFLQVLEQTECQHLHTKGRKHGRKGKKHHHKRSHSPSGSESEEEELPPPSLRPPKR
RRRNPSESGSEPSSSLDSVESGGAALGGRGSPSSHLLGADHGLRKAKKPKKKTKKRRHKS
NSPESETDPEEKAGKESDEKEQEQDKDRELQQAELPNRSPGFGIKKEKTGWDTSESELSE
GELERRRRTLLQQLDDHQ
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgccccctccagggatccccccaccctttcctccgatggggctaccccccatgagtcag
agaccaccagctatcccccccatgccacctggcatcctgcccccaatgcttccaccaatg
ggggcgccaccaccactcacacagataccaggaatggtacctccgatgatgccaggaatg
ctgatgccagcggtgcctgtcaccgcagcgacggctccgggtgcggacaccgccagctct
gctgtggctgggacaggccctccgagggccctatggagtgagcatgtggccccagatggg
cgcatctactactacaatgctgacgacaagcagtccgtgtgggagaagcccagcgtgctc
aagtccaaggcagagctgctcctgtcccaatgtccctggaaagagtacaagtcggacaca
ggcaaaccttattactataacaaccagagtaaagagtcccgctggacccggcccaaggat
ctggatgacctagaggttctagtcaaacaagaggctgcagggaaacagcagcagcagctg
ccacagacacttcagccacagccacctcagccacagcctgaccccccacctgtgcctcct
ggccccaccccagtgcccacaggcctcctggaacctgagccaggtgggagtgaagattgt
gatgtgttggaggccacccagcccctggaacaggggttcctgcagcagctggaggagggc
cccagcagttctggacagcatcagccacagcaggaggaggaggaatcaaagccagaacca
gagaggtctggcctcagttggagcaaccgggagaaggcaaagcaggcattcaaggaactg
ctgagggacaaggctgtcccctccaatgcctcatgggaacaggccatgaagatggtggtc
accgacccccgttacagtgccttgcctaaactgagtgagaaaaagcaggcattcaatgcc
tacaaggcgcagcgggagaaggaggagaaggaggaggcccggctaagggccaaagaggcc
aagcagaccctgcagcatttcctggagcagcatgaacgcatgacctccaccacccgctac
cggcgggcagaacagacctttggggagctggaggtctgggctgtggtccctgagagggat
cgaaaagaggtttatgatgatgtcctcttcttcctggccaagaaggagaaggaacaggcc
aagcagctccggcgccgcaatatccaggccctaaagagcatcctggatgggatgagtagt
gtcaacttccaaaccacgtggtcccaggcccagcagtacctcatggataaccccagcttt
gctcaggaccatcagctgcagaacatggacaaggaagatgcactgatctgttttgaggag
cacatccgagctttggagagggaagaggaggaggaacgggagcgggcccggcttcgggag
cgacgccaacaacgcaagaatcgggaggccttccagaccttcctggacgagctgcatgag
acagggcagctgcactctatgtccacctggatggagctatatccagcagtcagcactgat
gtccgctttgccaacatgctgggccagccgggctccacccctctggacttattcaagttc
tatgtggaggagttgaaggcacgattccatgatgaaaagaagatcattaaggacatcctt
aaggtgaacacggcctttgaggacttcgcccacgtcataagctttgacaagagggctgcc
gcactggacgcaggcaacatcaagctgaccttcaatagtctgctggagaaagcagaggca
cgggagagggagcgggagaaggaggaggcacgcaggatgcggcgcagggaagctgccttt
cgaagcatgctgaggcaggctgtgcctgctctggagctaggcactgcctgggaagaggtc
cgtgagcgttttgtgtgtgactcagcctttgagcagatcaccctggagtcggagcggatc
cggctcttccgggagttcctacaggtgctggagcagactgaatgccagcacctccacacc
aaaggccgaaagcatggcaggaaaggcaagaagcaccatcacaagcgttcccactcaccc
tcaggctctgagtcagaagaagaggagctgcccccaccatctctccggccccccaagcgg
aggaggcggaacccctcagagtcaggctctgagccctcttcctcacttgattcagttgaa
agtgggggtgctgcccttggaggacggggctccccttcctcccatcttcttggagcagat
catggccttcggaaagccaagaaaccaaaaaagaaaactaagaagagaagacacaagtcg
aatagtcctgagagtgagacagaccctgaggagaaagctggcaaggagagcgatgagaaa
gaacaagaacaggacaaggacagggagctccaacaggcagagctccctaaccgttcccca
ggctttggaatcaagaaggagaagacaggctgggacacgtcagaaagtgagctgagtgag
ggtgagctggagaggcggcggcggacactcctacagcagctggatgatcaccagtga

KEGG   Homo sapiens (human): 55660Help
Entry
55660             CDS       T01001                                 

Gene name
PRPF40A, FBP-11, FBP11, FLAF1, FNBP3, HIP-10, HIP10, HYPA, NY-REN-6, Prp40
Definition
(RefSeq) pre-mRNA processing factor 40 homolog A
  KO
K12821  
pre-mRNA-processing factor 40
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    55660 (PRPF40A)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    55660 (PRPF40A)
 Complex B
    55660 (PRPF40A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O75400(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2q23.3
AA seq 930 aa AA seqDB search
MCSGSGRRRSSLSPTMRPGTGAERGGLMMGHPGMHYAPMGMHPMGQRANMPPVPHGMMPQ
MMPPMGGPPMGQMPGMMSSVMPGMMMSHMSQASMQPALPPGVNSMDVAAGTASGAKSMWT
EHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQLLSKCPWKEYKSDSGKPYYYNSQTKES
RWAKPKELEDLEGYQNTIVAGSLITKSNLHAMIKAEESSKQEECTTTSTAPVPTTEIPTT
MSTMAAAEAAAAVVAAAAAAAAAAAAANANASTSASNTVSGTVPVVPEPEVTSIVATVVD
NENTVTISTEEQAQLTSTPAIQDQSVEVSSNTGEETSKQETVADFTPKKEEEESQPAKKT
YTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQ
TEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMFGEMEVWNAISERDRLEI
YEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYLMDNPTFAEDE
ELQNMDKEDALICFEEHIRALEKEEEEEKQKSLLRERRRQRKNRESFQIFLDELHEHGQL
HSMSSWMELYPTISSDIRFTNMLGQPGSTALDLFKFYVEDLKARYHDEKKIIKDILKDKG
FVVEVNTTFEDFVAIISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKE
SAFKSMLKQAAPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVLEHECQHH
HSKNKKHSKKSKKHHRKRSRSRSGSDSDDDDSHSKKKRQRSESRSASEHSSSAESERSYK
KSKKHKKKSKKRRHKSDSPESDAEREKDKKEKDRESEKDRTRQRSESKHKSPKKKTGKDS
GNWDTSGSELSEGELEKRRRTLLEQLDDDQ
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagcggcagtggccgccggcggagcagtctgagcccgacgatgaggccggggacg
ggagctgagcgtggaggcctcatgatggggcaccctggcatgcattatgccccaatggga
atgcaccctatgggtcagagagcgaatatgcctcctgtacctcatggaatgatgccgcag
atgatgccccctatgggagggccaccaatgggacaaatgcctggaatgatgtcgtcagta
atgcctggaatgatgatgtctcatatgtctcaggcttccatgcagcctgccttaccgcca
ggagtaaatagtatggatgtagcagcaggtacagcatctggtgcaaaatcaatgtggact
gaacataaatcacctgatggaaggacttactactacaacactgaaaccaaacagtctacc
tgggagaaaccagatgatcttaaaacacctgctgagcaactcttatctaaatgcccctgg
aaggaatacaaatcagattctggaaagccttactattataattctcaaacaaaagaatct
cgctgggccaaacctaaagaacttgaggatcttgaaggataccagaataccattgttgct
ggaagtcttattacaaaatcaaacctgcatgcaatgatcaaagctgaagaaagcagtaag
caagaagagtgcaccacaacatcaacagccccagtccctacaacagaaattccgaccaca
atgagcaccatggctgctgccgaagcagcagctgctgttgttgcagcagcagcagcggca
gcagcagcagcagctgcagccaatgctaatgcttccacttctgcttctaatactgtcagt
ggaactgttccagttgttcctgagcctgaagttacttccattgttgctactgttgtagat
aatgagaatacagtaactatttcaactgaggaacaagcacaacttactagtacccctgct
attcaggatcaaagtgtggaagtatccagtaatactggagaagaaacatctaagcaagaa
actgtagctgattttactcccaaaaaagaagaggaggagagccaaccagcaaagaaaaca
tacacttggaatacaaaggaagaggcaaagcaagcttttaaagaattattgaaagaaaag
cgggtaccatcgaatgcttcatgggagcaggctatgaaaatgattattaatgatccacga
tacagtgctttggcaaagttaagtgaaaaaaagcaagcctttaatgcctataaagtccag
acagaaaaagaagaaaaagaagaagcaagatcaaagtacaaagaggctaaggaatccttt
cagcgttttcttgaaaatcatgagaaaatgacttctacaaccagatacaaaaaagcagag
caaatgtttggagagatggaagtttggaatgcaatatcagaacgtgatcgtcttgaaatc
tatgaagatgttttgttctttctttcaaaaaaagaaaaggaacaagcaaagcagttgcga
aagagaaattgggaagccttaaaaaacatacttgacaacatggctaatgtaacatactct
accacttggtctgaagcccagcagtatctgatggataatccaacttttgcagaagatgag
gagttacaaaatatggacaaagaagatgcattaatttgctttgaagaacacattcgggct
ttagaaaaggaggaagaagaagaaaaacagaagagtttgctgagagaaaggagacgacag
cgaaaaaatagggaatctttccagatatttttagatgaattacatgaacatggacaactg
cattctatgtcatcttggatggaattgtatccaactattagttctgatattagattcact
aatatgcttggtcagcctggatcaactgcacttgatcttttcaagttttatgttgaggat
cttaaagcacgttatcatgacgagaagaagataataaaagacattctaaaggataaagga
tttgtagttgaagtaaacactacttttgaagattttgtggcgataatcagttcaactaaa
agatcaactacattagatgctggaaatatcaaattggctttcaatagtttactagaaaag
gcagaagcccgtgaacgtgaaagagaaaaagaagaggctcggaagatgaaacgaaaagaa
tctgcatttaagagtatgttaaaacaagctgctcctccgatagaattggatgctgtctgg
gaagatatccgtgagagatttgtaaaagagccagcatttgaggacataactctagaatct
gaaagaaaacgaatatttaaagattttatgcatgtgcttgagcatgaatgtcagcatcat
cattcaaagaacaagaaacattctaagaaatctaaaaaacatcataggaaacgttcccgc
tctcgatcggggtcagattcagatgatgatgatagccattcaaagaaaaaaagacagcga
tcagagtctcgttctgcttcagaacattcttctagtgcagagtctgagagaagttataaa
aagtcaaaaaagcataagaagaaaagtaagaagaggagacataaatctgactctccagaa
tccgatgctgagcgagagaaggataaaaaagaaaaagatcgggaaagtgaaaaagacaga
actagacaaagatcagaatcaaaacacaaatcgcctaagaaaaagactggaaaggattct
ggtaattgggatacttctggcagcgaactgagtgaaggggaattggaaaagcgcagaaga
acccttttggagcaactggatgatgatcaataa

DBGET integrated database retrieval system