KEGG   Homo sapiens (human): 25778Help
Entry
25778             CDS       T01001                                 

Gene name
DSTYK, CAKUT1, DustyPK, HDCMD38P, RIP5, RIPK5
Definition
(RefSeq) dual serine/threonine and tyrosine protein kinase (EC:2.7.12.1)
  KO
K16288  
receptor-interacting serine/threonine-protein kinase 5 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     25778 (DSTYK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  Other families
   25778 (DSTYK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q32.1
AA seq 929 aa AA seqDB search
MEGDGVPWGSEPVSGPGPGGGGMIRELCRGFGRYRRYLGRLRQNLRETQKFFRDIKCSHN
HTCLSSLTGGGGAERGPAGDVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQD
CNVKCQLLNLLLGVQVLPTTKLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAH
QGNWETIPEEDLEVQENNEDAAHVLAELEVTMHHALLQEVDVVVAPCQGLRPTVDVLGDL
VNDFLPVITYALHKDELSERDEQELQEIRKYFSFPVFFFKVPKLGSEIIDSSTRRMESER
SPLYRQLIDLGYLSSSHWNCGAPGQDTKAQSMLVEQSEKLRHLSTFSHQVLQTRLVDAAK
ALNLVHCHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMI
VETLNTMKEELLDDATNMEFKDVIVPENGEPVGTREIKCCIRQIQELIISRLNQAVANKL
ISSVDYLRESFVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRM
LWEQIKQIIQRITWVSPPAITLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAF
AASLRQLEAGHSGRLEKTEDLWLRVRKDHAPRLARLSLESCSLQDVLLHRKPKLGQELGR
GQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSVIDY
NYGGGSSIAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHSQGLVHRDIKL
KNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWY
ICSGSVKLPEAFERCASKDHLWNNVRRGARPERLPVFDEECWQLMEACWDGDPLKRPLLG
IVQPMLQGIMNRLCKSNSEQPNRGLDDST
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgacggggtgccatggggcagcgagcccgtctcgggtcccggccccggcggc
ggcggaatgatccgcgagctgtgccggggcttcggccgctaccgccgctacctgggacgg
ctgcgacagaacctgcgcgagacccagaagttcttccgcgacatcaagtgctcccacaac
cacacttgtctctcctccctcacgggcggcggcggggccgagcgcggccctgcaggcgat
gtcgccgaaaccgggctgcaggcgggccaactgagctgcatttccttcccacctaaggaa
gagaagtacctccagcagattgtggactgcctcccttgcatactgatcctcggccaggat
tgtaacgtcaagtgccagctgttgaatctgctgttgggggtgcaggtgcttcccaccacc
aagctgggcagtgaggagagctgtaagcttcggcgcctccgcttcacctatgggactcag
actcgggtcagcctggcgctccctggacagtatgaactagtgcacacgctggttgctcat
cagggcaactgggagaccatccctgaggaggatctggaggtccaagagaacaatgaggat
gctgctcatgttttagcggaactggaggtaacgatgcaccatgctctcttacaggaagtg
gacgttgtggtagcaccatgccaaggcctccggcccacagtggatgttctgggtgacttg
gtgaatgatttcttgcctgtgataacctatgcactccacaaagatgaactctctgagagg
gatgagcaagagcttcaggaaatccgaaagtatttctcctttcctgtattctttttcaaa
gtgccgaaactgggctcggagataatagactcctcaaccaggagaatggagagcgaaaga
tcaccgctttatcgccagctaattgacctgggctatctgagcagcagtcactggaactgt
ggggctcctggccaggatactaaagctcagagcatgttggtggaacagagtgaaaagctg
agacacttgagcacattttctcaccaggtgttacagactcgcctggtggatgcagccaag
gccctgaacctggtgcactgccactgccttgacatctttattaaccaggcatttgacatg
cagcgggacctgcagatcactcccaaacgtctggaatatactcgaaaaaaggagaatgag
ttgtatgaatcattgatgaatattgccaaccgaaagcaggaggaaatgaaggatatgatt
gttgagacacttaataccatgaaggaggaacttctggatgatgctactaacatggagttt
aaagacgtcattgtccctgagaatggagaaccagtaggcaccagagagatcaaatgctgc
atccgacagatccaggaactcatcatctcccgacttaatcaggcagtggctaataagctg
atcagctcagtggattacctgagggaaagcttcgtcggaaccctggaacgatgtctgcag
agcctggagaagtctcaggatgtctcagttcacatcaccagtaattatctcaaacagatc
ttaaatgctgcctatcatgttgaagtcacgtttcactcagggtcgtcagttacaaggatg
ctatgggagcaaatcaaacagatcatccagcgcatcacatgggtgagcccacctgccatc
actctggaatggaagaggaaggtggcccaggaagccattgagagcctcagcgcctccaaa
ttggctaagagcatttgcagccaattccggactcggctcaatagttcccacgaggctttt
gcagcctccttgcggcagctggaagctggccactcaggccggttagagaaaacggaagat
ctatggctgagggttcggaaagatcatgctccccgcctggcccgcctttctctggaaagc
tgttctttacaggatgtcttgcttcatcgtaaacctaaactgggacaggaactgggccgg
ggccagtatggtgtggtatacctgtgtgacaactggggaggacacttcccttgtgccctc
aaatcagttgtccctccagatgagaagcactggaatgatctggctttggaatttcactat
atgaggtctctgccgaagcatgagcgattggtggatctccatggttcagtcattgactac
aactatggtggtggctccagcattgctgtgctcctcattatggagcggctacaccgggat
ctctacacagggctgaaggctgggctgaccctggagacacgtttgcagatagcactagat
gtggtggagggaatccgcttcctgcacagccagggacttgtccatcgtgatatcaaactg
aaaaatgtgctgctggataagcagaaccgtgccaagatcactgacttaggattctgcaag
ccagaggccatgatgtcaggcagcattgtggggacaccaatccatatggcccctgaactt
ttcacagggaagtacgataattccgtggatgtctacgcttttggaattcttttctggtat
atctgctcaggctctgtcaagctccctgaggcatttgagaggtgtgctagcaaagaccat
ctctggaacaatgtgcggaggggggctcgcccagaacgtcttcctgtgtttgatgaggag
tgctggcagttgatggaagcctgttgggatggcgaccccttgaagaggcctctcttgggc
attgtccagcccatgctccagggcatcatgaatcggctctgcaagtccaattctgagcag
ccaaacagaggactagatgattctacttga

DBGET integrated database retrieval system