KEGG   Homo sapiens (human): 25788Help
Entry
25788             CDS       T01001                                 

Gene name
RAD54B, RDH54
Definition
RAD54 homolog B (S. cerevisiae)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    25788 (RAD54B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     25788 (RAD54B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q22.1
AA seq 117 aa AA seqDB search
MRRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINNTFLPSQNDL
RICSLNLPSEESTREINNRDNCSGKYCFEAPTLATLDPPHTVQTWMRRHRLVPVHYR
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgagacgatctgcagcaccaagtcagttgcaggggaattccttcaaaaaaccaaaattt
atacctccaggaagaagtaatccaggtctgaatgaagagattacaaaactgaatccagat
ataaaattatttgagggtgttgcaattaataacacctttctcccgtcacaaaatgatctt
agaatatgcagtttaaatctgcctagtgaagaaagtactagagaaatcaataacagagat
aattgcagtggaaaatattgttttgaagcacctacactggcaacattagatccacctcat
acagtgcaaacttggatgaggaggcacaggctggtaccagttcactacaggtaa

DBGET integrated database retrieval system