KEGG   Homo sapiens (human): 25791Help
Entry
25791             CDS       T01001                                 

Gene name
NGEF, ARHGEF27, EPHEXIN
Definition
neuronal guanine nucleotide exchange factor
Orthology
K07525  
neuronal guanine nucleotide exchange factor
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Class
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37
AA seq 618 aa AA seqDB search
MELLAAAFSAACAVDHDSSTSESDARDSAAGHLPGSESSSTPGNGATPEEWPALADSPTT
LTEALRMIHPIPADSWRNLIEQIGLLYQEYRDKSTLQEIETRRQQDAEIEDNTNGSPASE
DTPEEEEEEEEEEEPASPPERKTLPQICLLSNPHSRFNLWQDLPEIRSSGVLEILQPEEI
KLQEAMFELVTSEASYYKSLNLLVSHFMENERIRKILHPSEAHILFSNVLDVLAVSERFL
LELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIA
QLELDPKCRGLPFSSFLILPFQRITRLKLLVQNILKRVEERSERECTALDAHKELEMVVK
ACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKK
LFHEIYLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQTLANVFILRLLENA
DDREATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDCPQVQCVHPYVAQQPDELT
LELADILNILDKTDDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMDD
PQRSQNKDRRKLGSRNRQ
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctggccgctgccttcagcgccgcctgcgccgtggaccacgacagttccacc
tcggaaagcgacgcgcgcgactcggcggcgggacacctgcccggcagtgagtcgtcctcc
accccgggaaatggggccacgcccgaggagtggccggccctggccgacagccccaccacg
ctcaccgaggccctgcggatgatccaccccattcccgccgactcctggagaaacctcatt
gaacaaatagggctcctgtatcaggaataccgagataaatcgactctccaagaaatcgaa
accaggaggcaacaggatgcagaaatagaagacaataccaatgggtccccggccagtgag
gacaccccggaggaggaagaagaagaggaggaggaggaggagccggccagcccaccagag
aggaagactctgccccagatctgcctgctcagtaacccccactcaaggttcaacctctgg
caggatcttcccgagatccggagcagcggggtgcttgagatcctacagcccgaggagatt
aagctgcaggaggccatgttcgagctggtcacttccgaggcgtcctactacaagagtctg
aacctgctcgtgtcccacttcatggagaacgagcggataaggaagatcctgcacccgtcc
gaggcgcacatcctcttctccaacgtcctggacgtgctggctgtcagtgagcggttcctc
ctggagctggagcaccggatggaggagaacatcgtcatctctgacgtgtgtgacattgtg
taccgttatgcggccgaccacttctctgtctacatcacctacgtcagcaatcagacctac
caggagcggacctataagcagctgctccaggagaaggcagctttccgggagctgatcgcg
cagctagagctcgaccccaagtgcagggggctgcccttctcctccttcctcatcctgcct
ttccagaggatcacacgcctcaagctgttggtccagaacatcctgaagagggtagaagag
aggtctgagcgggagtgcactgctttggatgctcacaaggagctggaaatggtggtgaag
gcatgcaacgagggcgtcaggaaaatgagccgcacggaacagatgatcagcattcagaag
aagatggagttcaagatcaagtcggtgcccatcatctcccactcccgctggctgctgaag
cagggtgagctgcagcagatgtcaggccccaagacctcccggaccctgaggaccaagaag
ctcttccacgaaatttacctcttcctgttcaacgacctgctggtgatctgccggcagatt
ccaggagacaagtaccaggtatttgactcagctccgcggggactgctgcgtgtggaggag
ctggaggaccagggccagacgctggccaacgtgttcatcctgcggctgctggagaacgca
gatgaccgggaggccacctacatgctaaaggcgtcctctcagagtgagatgaagcgttgg
atgacctcactggcccccaacaggaggaccaagtttgtttcgttcacatcccggctgctg
gactgcccccaggtccagtgcgtgcacccatacgtggctcagcagccagacgagctgacg
ctggagctcgccgacatcctcaacatcctggacaagactgacgacgggtggatctttggc
gagcgtctgcacgaccaggagagaggctggttccccagctccatgactgaggagatcttg
aatcccaagatccggtcccagaacctcaaggaatgtttccgtgtccacaagatggatgac
cctcagcgcagccagaacaaggaccgcaggaagctgggcagccggaatcggcaatga

DBGET integrated database retrieval system