KEGG   Homo sapiens (human): 25791Help
Entry
25791             CDS       T01001                                 

Gene name
NGEF, ARHGEF27, EPHEXIN
Definition
(RefSeq) neuronal guanine nucleotide exchange factor
  KO
K07525  
neuronal guanine nucleotide exchange factor
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    25791 (NGEF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37
AA seq 710 aa AA seqDB search
METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIK
RNSIFNRSIRRKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRMPPCRTAMQT
DPGAQEMSESSSTPGNGATPEEWPALADSPTTLTEALRMIHPIPADSWRNLIEQIGLLYQ
EYRDKSTLQEIETRRQQDAEIEDNTNGSPASEDTPEEEEEEEEEEEPASPPERKTLPQIC
LLSNPHSRFNLWQDLPEIRSSGVLEILQPEEIKLQEAMFELVTSEASYYKSLNLLVSHFM
ENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCDIVYRYAADHF
SVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRLK
LLVQNILKRVEERSERECTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKS
VPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGDKYQVF
DSAPRGLLRVEELEDQGQTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNR
RTKFVSFTSRLLDCPQVQCVHPYVAQQPDELTLELADILNILDKTDDGWIFGERLHDQER
GWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggagaccagggaatctgaagatttggaaaagacccggaggaaatcagcaagtgatcaa
tggaacactgataatgaaccagccaaggtgaaacctgagttactcccagaaaaagaggag
acttctcaagctgaccaggatatccaagacaaagagcctcattgccacatcccaattaag
agaaattccatcttcaatcgctccataagacgcaaaagcaaagccaaggccagagacaac
cccgaacggaacgccagctgcctggcagattcacaggacaatggaaaatctgtaaatgag
cccctgaccttgaatatcccctggagcagaatgcctccttgcagaacagcaatgcagaca
gacccaggagcccaggaaatgagtgagtcgtcctccaccccgggaaatggggccacgccc
gaggagtggccggccctggccgacagccccaccacgctcaccgaggccctgcggatgatc
caccccattcccgccgactcctggagaaacctcattgaacaaatagggctcctgtatcag
gaataccgagataaatcgactctccaagaaatcgaaaccaggaggcaacaggatgcagaa
atagaagacaataccaatgggtccccggccagtgaggacaccccggaggaggaagaagaa
gaggaggaggaggaggagccggccagcccaccagagaggaagactctgccccagatctgc
ctgctcagtaacccccactcaaggttcaacctctggcaggatcttcccgagatccggagc
agcggggtgcttgagatcctacagcccgaggagattaagctgcaggaggccatgttcgag
ctggtcacttccgaggcgtcctactacaagagtctgaacctgctcgtgtcccacttcatg
gagaacgagcggataaggaagatcctgcacccgtccgaggcgcacatcctcttctccaac
gtcctggacgtgctggctgtcagtgagcggttcctcctggagctggagcaccggatggag
gagaacatcgtcatctctgacgtgtgtgacattgtgtaccgttatgcggccgaccacttc
tctgtctacatcacctacgtcagcaatcagacctaccaggagcggacctataagcagctg
ctccaggagaaggcagctttccgggagctgatcgcgcagctagagctcgaccccaagtgc
agggggctgcccttctcctccttcctcatcctgcctttccagaggatcacacgcctcaag
ctgttggtccagaacatcctgaagagggtagaagagaggtctgagcgggagtgcactgct
ttggatgctcacaaggagctggaaatggtggtgaaggcatgcaacgagggcgtcaggaaa
atgagccgcacggaacagatgatcagcattcagaagaagatggagttcaagatcaagtcg
gtgcccatcatctcccactcccgctggctgctgaagcagggtgagctgcagcagatgtca
ggccccaagacctcccggaccctgaggaccaagaagctcttccacgaaatttacctcttc
ctgttcaacgacctgctggtgatctgccggcagattccaggagacaagtaccaggtattt
gactcagctccgcggggactgctgcgtgtggaggagctggaggaccagggccagacgctg
gccaacgtgttcatcctgcggctgctggagaacgcagatgaccgggaggccacctacatg
ctaaaggcgtcctctcagagtgagatgaagcgttggatgacctcactggcccccaacagg
aggaccaagtttgtttcgttcacatcccggctgctggactgcccccaggtccagtgcgtg
cacccatacgtggctcagcagccagacgagctgacgctggagctcgccgacatcctcaac
atcctggacaagactgacgacgggtggatctttggcgagcgtctgcacgaccaggagaga
ggctggttccccagctccatgactgaggagatcttgaatcccaagatccggtcccagaac
ctcaaggaatgtttccgtgtccacaagatggatgaccctcagcgcagccagaacaaggac
cgcaggaagctgggcagccggaatcggcaatga

DBGET integrated database retrieval system