KEGG   Homo sapiens (human): 2580Help
Entry
2580              CDS       T01001                                 

Gene name
GAK, DNAJ26, DNAJC26
Definition
(RefSeq) cyclin G associated kinase (EC:2.7.11.1)
  KO
K08855  
cyclin G-associated kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     2580 (GAK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  NAK family [OT]
   2580 (GAK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p16
AA seq 1311 aa AA seqDB search
MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDV
GSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFL
LLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLL
LSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPI
GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNP
EERLSIAEVVHQLQEIAAARNVNPKSPITELLEQNGGYGSATLSRGPPPPVGPAGSGYSG
GLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVM
SFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAP
HLHTLYNICRNMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFS
MKRCPPGIWPSHKRYIEYMCDMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCE
VYVGDERVASTSQEYDKMRDFKIEDGKAVIPLGVTVQGDVLIVIYHARSTLGGRLQAKMA
SMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAP
PWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGSPEAEPTDSDS
PPSSSADASRFLHTLDWQEEKEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEG
QEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDGVDLLGLHSEVGAGPAVPPQA
CKAPSSNTDLLSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADP
FGPLLPSSGNNSQPCSNPDLFGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGE
PSKMTASSSNPDLLGGWAAWTETAASAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNP
DPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPK
ACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFSSRSDKKGPKT
IAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAP
EQVKKHYRRAVLAVHPDKAAGQPYEQHAKMIFMELNDAWSEFENQGSRPLF
NT seq 3936 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgctgcagtcggcgctcgacttcttggcgggtccaggctccctgggcggtgct
tccggccgcgaccagagtgacttcgtggggcagacggtggaactgggcgagctgcggctg
cgggtgcggcgggtcctggccgaaggagggtttgcatttgtgtatgaagctcaagatgtg
gggagtggcagagagtatgcattaaagaggctattatccaatgaagaggaaaagaacaga
gccatcattcaagaagtttgcttcatgaaaaagctttccggccacccgaacattgtccag
ttttgttctgcagcgtctataggaaaagaggagtcagacacggggcaggctgagttcctc
ttgctcacagagctctgtaaagggcagctggtggaatttttgaagaaaatggaatctcga
ggccccctttcgtgcgacacggttctgaagatcttctaccagacgtgccgcgccgtgcag
cacatgcaccggcagaagccgcccatcatccacagggacctcaaggttgagaacttgttg
cttagtaaccaagggaccattaagctgtgtgactttggcagtgccacgaccatctcgcac
taccctgactacagctggagcgcccagaggcgagccctggtggaggaagagatcacgagg
aatacaacaccaatgtatagaacaccagaaatcatagacttgtattccaacttcccgatc
ggcgagaagcaggatatctgggccctgggctgcatcttgtacctgctgtgcttccggcag
cacccttttgaggatggagcgaaacttcgaatagtcaatgggaagtactcgatccccccg
cacgacacgcagtacacggtcttccacagcctcatccgcgccatgctgcaggtgaacccg
gaggagcggctgtccatcgccgaggtggtgcaccagctgcaggagatcgcggccgcccgc
aacgtgaaccccaagtctcccatcacagagctcctggagcagaatggaggctacgggagc
gccacactgtcccgagggccaccccctcccgtgggccccgctggcagtggctacagtgga
ggcctggcgctggcggagtacgaccagccgtatggcggcttcctggacattctgcggggt
gggacagagcggctcttcaccaacctcaaggacacctcctccaaggtcatccagtccgtc
gctaattatgcaaagggtgacctggacatatcttacatcacatccagaattgcagtgatg
tcattcccagcagaaggtgtggagtcagcgctcaaaaacaacatcgaagatgtgcggttg
ttcctggactccaagcacccagggcactatgccgtctacaacctgtccccgaggacctac
cggccctccaggttccacaaccgggtctccgagtgtggctgggcagcacggcgggcccca
cacctgcacaccctgtacaacatctgcaggaacatgcacgcctggctgcggcaggaccac
aagaacgtctgcgtcgtgcactgcatggacgggagagccgcgtctgctgtggccgtctgc
tccttcctgtgcttctgccgtctcttcagcaccgcggaggccgccgtgtacatgttcagc
atgaagcgctgcccaccaggcatctggccatcccacaaaaggtacatcgagtacatgtgt
gacatggtggcggaggagcccatcacaccccacagcaagcccatcctggtgagggccgtg
gtcatgacacccgtgccgctgttcagcaagcagaggagcggctgcaggcccttctgcgag
gtctacgtgggggacgagcgtgtggccagcacctcccaggagtacgacaagatgcgggac
tttaagattgaagatggcaaagcggtgattcccctgggcgtcacggtgcaaggagacgtg
ctcatcgtcatctatcacgcccggtccactctgggcggccggctgcaggccaagatggca
tccatgaagatgttccagattcagttccacacggggtttgtgcctcggaacgccaccact
gtgaaatttgccaagtatgacctggacgcgtgtgacattcaagaaaaatacccggattta
tttcaagtgaacctggaagtggaggtggagcccagggacaggccgagccgggaagcccca
ccatgggagaactcgagcatgagggggctgaaccccaaaatcctgttttccagccgggag
gagcagcaagacattctgtctaagtttgggaagccggagcttccccggcagcctggctcc
acggctcagtatgatgctggggcagggtccccggaagccgaacccacagactctgactca
ccgccaagcagcagcgcggacgccagtcgcttcctgcacacgctggactggcaggaagag
aaggaggcagagactggtgcagaaaatgcctcttccaaggagagcgagtctgccctgatg
gaggacagagacgagagtgaggtgtcagatgaagggggatccccgatctccagcgagggc
caggaacccagggccgacccagagccccccggcctggcagcagggctggtgcagcaggac
ttggtttttgaggtggagacaccggctgtgctgccagagcctgtgccacaggaagacggg
gtcgacctcctgggcctgcactccgaggtgggcgcagggccagctgtacccccgcaggcc
tgcaaggccccctccagcaacaccgacctgctcagctgcctccttgggccccctgaggcc
gcctcccaggggcccccggaggatctgctcagcgaggacccgctgctcctggcaagcccg
gcccctcccctgagcgtgcagagcaccccaagaggagggccccctgccgctgctgacccc
tttggcccgcttctgccgtcttcaggcaacaactcccagccctgctccaatcctgatctc
ttcggcgaatttctcaattcggactctgtgaccgtcccaccatccttcccgtctgcccac
agtgctccgcccccatcctgcagcgccgacttcctgcacctgggggatctgccaggagag
cccagcaagatgacagcctcgtccagcaacccagacctgctgggaggatgggctgcctgg
accgagactgcagcatcggcagtggcccccacgccagccacagaaggccccctcttctct
cctggaggtcagccggccccttgtggctctcaggccagctggaccaagtctcagaacccg
gacccatttgctgaccttggcgacctcagctccggcctccaaggctcaccagctggattc
cctcctgggggcttcattcccaaaacggccaccacgcccaaaggcagcagctcctggcag
acaagtcggccgccagcccagggcgcctcatggccccctcaggccaagccgccccccaaa
gcctgcacacagccaaggcctaactatgcctcgaacttcagtgtgatcggggcgcgggag
gagcggggggtccgcgcacccagctttgctcaaaagccaaaagtctctgagaacgacttt
gaagatctgttgtccaatcaaggcttctcctccaggtctgacaagaaagggccaaagacc
attgcagagatgaggaagcaggacctggctaaagacacggacccactcaagctgaagctc
ctggactggattgagggcaaggagcggaacatccgggccctgctgtccacgctgcacaca
gtgctgtgggacggggagagccgctggacgcccgtgggcatggccgacctggtggctccg
gagcaagtgaagaagcactatcgccgcgcggtgctggctgtgcaccccgacaaggctgcg
gggcagccgtacgagcagcacgccaagatgatcttcatggagctgaatgacgcctggtcg
gagtttgagaaccagggctcccggcccctcttctga

DBGET integrated database retrieval system