KEGG   Homo sapiens (human): 258010Help
Entry
258010            CDS       T01001                                 

Gene name
SVIP
Definition
(RefSeq) small VCP interacting protein
  KO
K14014  
small VCP/p97-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    258010 (SVIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8NHG7(Tbio)
UniProt: 
Position
11p14.3
AA seq 77 aa AA seqDB search
MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQ
IATSGPPPEGGLRFHKA
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atggggctgtgttttccttgtcccggggagtccgcgcctcccacgccggacctggaagag
aaaagagcaaagcttgcagaggctgcagagagaagacaaaaagaggctgcatctcgggga
attttagatgttcaatctgtgcaagaaaagagaaagaaaaaggaaaaaatagaaaaacaa
attgctacatccgggcccccaccagaaggtggacttaggtttcataaagcataa

DBGET integrated database retrieval system