KEGG   Homo sapiens (human): 25818Help
Entry
25818             CDS       T01001                                 

Gene name
KLK5, KLK-L2, KLKL2, SCTE
Definition
(RefSeq) kallikrein related peptidase 5
  KO
K09617  
kallikrein 5 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     25818 (KLK5)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   25818 (KLK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.33
AA seq 293 aa AA seqDB search
MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARS
DDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGH
YSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPS
AGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDS
CQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggctacagcaagacccccctggatgtgggtgctctgtgctctgatcacagccttgctt
ctgggggtcacagagcatgttctcgccaacaatgatgtttcctgtgaccacccctctaac
accgtgccctctgggagcaaccaggacctgggagctggggccggggaagacgcccggtcg
gatgacagcagcagccgcatcatcaatggatccgactgcgatatgcacacccagccgtgg
caggccgcgctgttgctaaggcccaaccagctctactgcggggcggtgttggtgcatcca
cagtggctgctcacggccgcccactgcaggaagaaagttttcagagtccgtctcggccac
tactccctgtcaccagtttatgaatctgggcagcagatgttccagggggtcaaatccatc
ccccaccctggctactcccaccctggccactctaacgacctcatgctcatcaaactgaac
agaagaattcgtcccactaaagatgtcagacccatcaacgtctcctctcattgtccctct
gctgggacaaagtgcttggtgtctggctgggggacaaccaagagcccccaagtgcacttc
cctaaggtcctccagtgcttgaatatcagcgtgctaagtcagaaaaggtgcgaggatgct
tacccgagacagatagatgacaccatgttctgcgccggtgacaaagcaggtagagactcc
tgccagggtgattctggggggcctgtggtctgcaatggctccctgcagggactcgtgtcc
tggggagattacccttgtgcccggcccaacagaccgggtgtctacacgaacctctgcaag
ttcaccaagtggatccaggaaaccatccaggccaactcctga

DBGET integrated database retrieval system