KEGG   Homo sapiens (human): 2583Help
Entry
2583              CDS       T01001                                 

Gene name
B4GALNT1, GALGT, GALNACT, GalNAc-T, SPG26
Definition
(RefSeq) beta-1,4-N-acetyl-galactosaminyltransferase 1
  KO
K00725  (N-Acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase [EC:2.4.1.92]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00604  Glycosphingolipid biosynthesis - ganglio series
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    2583 (B4GALNT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.92  (N-acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase
     2583 (B4GALNT1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Glycolipid
   2583 (B4GALNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 GspH Glyco_transf_49
Motif
Other DBs
NCBI-GeneID: 2583
NCBI-ProteinID: NP_001469
OMIM: 601873
HGNC: 4117
Ensembl: ENSG00000135454
Vega: OTTHUMG00000170190
Pharos: Q00973(Tbio)
UniProt: Q00973 B4DSP5
Position
12q13.3
AA seq 533 aa AA seqDB search
MWLGRRALCALVLLLACASLGLLYASTRDAPGLRLPLAPWAPPQSPRRPELPDLAPEPRY
AHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQ
EFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNL
TASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRF
STEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIR
RFYPTVTVVIADDSDKPERVSGPYVEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFV
FTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGLGNCLRQRRGFH
HELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHLEFFLDGLGSLRVGSCSDVV
VDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMAKHRLLFFKHRLQCMTSQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgggccgccgggccctgtgcgctctggtccttctgctcgcctgcgcctcgctg
gggctcctgtacgcgagcacccgggacgcgcccggcctccggctacctcttgcgccgtgg
gcgcccccgcaaagcccccgcaggcccgagctgccagatcttgctcctgagccccgctac
gcacacatcccggtcaggatcaaggagcaagtagtggggctgctggcttggaacaactgc
agttgtgagtccagtggggggggcctccccctccccttccagaaacaagtccgagctatt
gacctcaccaaggcctttgaccctgcagagctgagggctgcctctgccacaagagagcag
gagttccaggcctttctgtcgaggagccagtccccagctgaccagctgctcatagcccct
gccaactccccgctccagtaccccctacagggtgtggaagttcagcccctcaggagcatc
ttggtgccagggctgagccttcaggcagcttctggtcaggaggtataccaggtgaacctg
actgcctccctaggcacctgggacgtggcaggggaagtgactggagttactctcactgga
gagggtcaggcagatctcacccttgtcagcccagggctggaccaactcaacaggcaacta
caactggtcacttacagcagccgaagctaccagaccaacacagcagacacagtccggttc
tccaccgagggacatgaggctgctttcactatccgcataagacacccgcccaaccctcgg
ctgtacccacctgggtctctaccccagggagcccagtacaacatcagcgctctagtcacg
attgccaccaagaccttcctccgttatgatcggctacgggctctcatcaccagtatccgc
cgcttctacccaacggttaccgtggtcatcgctgacgacagcgacaagccagagcgcgtt
agtggcccctacgtggaacactatctcatgcccttcggcaagggctggttcgcaggccgg
aacctggccgtgtctcaagtaaccaccaagtacgtgctgtgggtggacgacgacttcgtc
ttcacggcgcggacgcggctggagaggcttgtggacgtgctggagcggacgccgctggac
ctggtggggggcgcggtgcgcgagatctccggctttgccaccacttatcggcagctgctg
agcgtggagcccggcgccccaggcctcgggaactgcctccggcaaaggcgcggcttccac
cacgagctcgtcggcttcccaggctgcgtggtcaccgacggcgtggttaacttcttcctg
gcgcggactgacaaggtgcgcgaggtcggtttcgacccccgcctcagccgcgtggctcat
ctggaattcttcttggatgggcttggttcccttcgggttggctcctgctccgacgtcgtg
gtggatcatgcatccaaactgaagctgccttggacatcaagggatgccggagcagagact
tacgcccggtaccgttacccaggatcactggacgagagccagatggccaaacaccggctg
ctcttcttcaaacaccggctgcagtgcatgacctcccagtga

DBGET integrated database retrieval system