KEGG   Homo sapiens (human): 25839Help
Entry
25839             CDS       T01001                                 

Gene name
COG4, CDG2J, COD1
Definition
(RefSeq) component of oligomeric golgi complex 4
  KO
K20291  
conserved oligomeric Golgi complex subunit 4
Organism
hsa  Homo sapiens (human)
Disease
H00119  
Congenital disorders of glycosylation (CDG) type II
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q22.1
AA seq 789 aa AA seqDB search
MGTKMADLDSPPKLSGVQQPSEGVGGGRCSEISAELIRSLTELQELEAVYERLCGEEKVV
ERELDALLEQQNTIESKMVTLHRMGPNLQLIEGDAKQLAGMITFTCNLAENVSSKVRQLD
LAKNRLYQAIQRADDILDLKFCMDGVQTALRSEDYEQAAAHTHRYLCLDKSVIELSRQGK
EGSMIDANLKLLQEAEQRLKAIVAEKFAIATKEGDLPQVERFFKIFPLLGLHEEGLRKFS
EYLCKQVASKAEENLLMVLGTDMSDRRAAVIFADTLTLLFEGIARIVETHQPIVETYYGP
GRLYTLIKYLQVECDRQVEKVVDKFIKQRDYHQQFRHVQNNLMRNSTTEKIEPRELDPIL
TEVTLMNARSELYLRFLKKRISSDFEVGDSMASEEVKQEHQKCLDKLLNNCLLSCTMQEL
IGLYVTMEEYFMRETVNKAVALDTYEKGQLTSSMVDDVFYIVKKCIGRALSSSSIDCLCA
MINLATTELESDFRDVLCNKLRMGFPATTFQDIQRGVTSAVNIMHSSLQQGKFDTKGIES
TDEAKMSFLVTLNNVEVCSENISTLKKTLESDCTKLFSQGIGGEQAQAKFDSCLSDLAAV
SNKFRDLLQEGLTELNSTAIKPQVQPWINSFFSVSHNIEEEEFNDYEANDPWVQQFILNL
EQQMAEFKASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLT
TVTTWTIRDKFARLSQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRQVLALRIDFR
SEDIKRLRL
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atggggaccaagatggcggaccttgattcgcctccgaagctgtcaggggtgcagcagccg
tctgagggggtgggaggtggccgctgctccgaaatctccgctgagctcattcgctccctg
acagagctgcaggagctggaggctgtatacgaacggctctgcggcgaggagaaagtggtg
gagagagagctggatgctcttttggaacagcaaaacaccattgaaagtaagatggtcact
ctccaccgaatgggtcctaatctgcagctgattgagggagatgcaaagcagctggctgga
atgatcacctttacctgcaacctggctgagaatgtgtccagcaaagttcgtcagcttgac
ctggccaagaaccgcctctatcaggccattcagagagctgatgacatcttggacctgaag
ttctgcatggatggagttcagactgctttgaggagtgaagattatgagcaggctgcagca
catactcatcgctacttgtgcctggacaagtcggtcattgagctcagccgacagggcaaa
gaggggagcatgattgatgccaacctgaaattgctgcaggaagctgagcaacgtctcaaa
gccattgtggcagagaagtttgccattgccaccaaggaaggtgatctgccccaggtggag
cgcttcttcaagatcttcccactgctgggtttgcatgaggagggattaagaaagttctcg
gagtacctttgcaagcaggtggccagtaaagctgaggagaatctgctcatggtgctgggg
acagacatgagtgatcggagagctgcagtcatctttgcagatacacttactcttctgttt
gaagggattgcccgcattgtggagacccaccagccaatagtggagacctattatgggcca
gggagactctataccctgatcaaatatctgcaggtggaatgtgacagacaggtggagaag
gtggtagacaagttcatcaagcaaagggactaccaccagcagttccggcatgttcagaac
aacctgatgagaaattctacaacagaaaaaatcgaaccaagagaactggaccccatcctg
actgaggtcaccctgatgaatgcccgcagtgagctatacttacgcttcctcaagaagagg
attagctctgattttgaggtgggagactccatggcctcagaggaagtaaagcaagagcac
cagaagtgtctggacaaactcctcaataactgccttttgagctgtaccatgcaggagcta
attggcttatatgttaccatggaggagtacttcatgagggagactgtcaataaggctgtg
gctctggacacctatgagaagggccagctgacatccagcatggtggatgatgtcttctac
attgttaagaagtgcattgggcgggctctgtccagctccagcattgactgtctctgtgcc
atgatcaacctcgccaccacagagctggagtctgacttcagggatgttctgtgtaataag
ctgcggatgggctttcctgccaccaccttccaggacatccagcgcggggtgacaagtgcc
gtgaacatcatgcacagcagcctccagcaaggcaaatttgacacaaaaggcatcgagagt
actgacgaggcgaagatgtccttcctggtgactctgaacaacgtggaagtctgcagtgaa
aacatctccactctgaagaagacactggagagtgactgcaccaagctcttcagccagggc
attggaggggagcaggcccaggccaagtttgacagctgcctttctgacttggccgccgtg
tccaacaaattccgagacctcttgcaggaagggctgacggagctcaacagcacagccatc
aagccacaggtgcagccttggatcaacagctttttctccgtctcccacaacatcgaggag
gaagaattcaatgactatgaggccaacgacccttgggtacaacagttcatccttaacctg
gagcagcaaatggcagagttcaaggccagcctgtccccggtcatctacgacagcctaacc
ggcctcatgactagccttgttgccgtcgagttggagaaagtggtgctgaaatccaccttt
aaccggctgggtggtctgcagtttgacaaggagctgaggtcgctcattgcctaccttacc
acggtgaccacctggaccatccgagacaagtttgcccggctctcccagatggccaccatc
ctcaatctggagcgggtgaccgagatcctcgattactggggacccaattccggcccattg
acgtggcgcctcacccctgctgaagtgcgccaggtgctggccctgcggatagacttccgc
agtgaagatatcaagaggctgcgcctgtag

DBGET integrated database retrieval system