KEGG   Homo sapiens (human): 25841Help
Entry
25841             CDS       T01001                                 

Gene name
ABTB2, ABTB2A, BTBD22
Definition
(RefSeq) ankyrin repeat and BTB domain containing 2
  KO
K10521  
ankyrin repeat and BTB/POZ domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Brite
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Target recognizing subunit (BTB)
     25841 (ABTB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p13
AA seq 1025 aa AA seqDB search
MAGTYSSTLKTLEDLTLDSGYGAGDSCRSLSLSSSKSNSQALNSSAQQHRGAAWWCYSGS
MNSRHNSWDTVNTVLPEDPEVADLFSRCPRLPELEEFPWTEGDVARVLRKGAGGRRLPQF
SAEAVRRLAGLLRRALIRVAREAQRLSVLHAKCTRFEVQSAVRLVHSWALAESCALAAVK
ALSLYSMSAGDGLRRGKSARCGLTFSVGRFFRWMVDTRISVRIHEYAAISLTACMENLVE
EIRARVMASHSPDGGGAGGGEVSAEALEMVINNDAELWGVLQPYEHLICGKNANGVLSLP
AYFSPYNGGSLGHDERADAYAQLELRTLEQSLLATCVGSISELSDLVSRAMHHMQGRHPL
CPGASPARQARQPPQPITWSPDALHTLYYFLRCPQMESMENPNLDPPRMTLNNERPFMLL
PPLMEWMRVAITYAEHRRSLTVDSGDIRQAARLLLPGLDCEPRQLKPEHCFSSFRRLDAR
AATEKFNQDLGFRMLNCGRTDLINQAIEALGPDGVNTMDDQGMTPLMYACAAGDEAMVQM
LIDAGANLDIQVPSNSPRHPSIHPDSRHWTSLTFAVLHGHISVVQLLLDAGAHVEGSAVN
GGEDSYAETPLQLASAAGNYELVSLLLSRGADPLLSMLEAHGMGSSLHEDMNCFSHSAAH
GHRNVLRKLLTQPQQAKADVLSLEEILAEGVEESDASSQGSGSEGPVRLSRTRTKALQEA
MYYSAEHGYVDITMELRALGVPWKLHIWIESLRTSFSQSRYSVVQSLLRDFSSIREEEYN
EELVTEGLQLMFDILKTSKNDSVIQQLATIFTHCYGSSPIPSIPEIRKTLPARLDPHFLN
NKEMSDVTFLVEGKLFYAHKVLLVTASNRFKTLMTNKSEQDGDSSKTIEISDMKYHIFQM
MMQYLYYGGTESMEIPTTDILELLSAASLFQLDALQRHCEILCSQTLSMESAVNTYKYAK
IHNAPELALFCEGFFLKHMKALLEQDAFRQLIYGRSSKVQGLDPLQDLQNTLAERVHSVY
ITSRV
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atggccgggacgtacagctcgactctgaagacgctggaggacttgaccttggactccggg
tatggggccggggactcgtgccgctcgctcagcctctcgtcctccaagtccaactcgcag
gcgctcaactcttcggcgcagcagcaccgcggggcggcctggtggtgctactccggctcc
atgaacagccgccacaacagctgggacacggtgaacacggtgctgcccgaggaccccgaa
gtggccgacctcttctcgcgctgtccgcggctccccgagctggaggagttcccctggacc
gaaggagacgtggcccgggtgctccgcaaaggcgctggcggccggcggctgccccagttc
tccgccgaggcggtgaggcgcctggccgggctgctccgcagggcactgatccgcgtggcc
cgcgaggcgcagcgcctgagcgtgctgcacgccaagtgcacccgctttgaggtgcagagc
gccgtgcgcctggtgcacagctgggcgctggccgagagctgcgcgctggcagccgtcaag
gcgctgtccctgtacagcatgagcgccggcgacgggctgcgccggggcaagtccgcgcgc
tgcggcctcaccttctcagtgggtcgctttttccgctggatggtggacacccgaatctcc
gtgcgcatccacgagtacgcagccatctccctcaccgcctgcatggagaacctggtggag
gagatccgggccagggtgatggccagccacagccctgatggcggaggggccggaggcggg
gaggtgtctgctgaggccctggagatggtcatcaacaacgacgccgagctctggggcgtc
ttgcagccctatgagcatctcatctgcggcaagaacgccaatggtgtcctctccctcccc
gcatacttcagcccctacaacggcgggtccctgggccatgacgagcgagccgatgcctat
gcccagctggagctccgaaccctggagcagtccctcctggccacctgcgtgggcagcatc
tcggagctgagtgacttggtctcccgtgccatgcaccacatgcaggggcgtcaccccctg
tgcccgggtgccagccctgcccgccaggcccgccagccgccacagcccatcacttggtcc
cccgacgccctccacacgctctactactttctgcggtgtccacagatggagtccatggag
aaccccaacctggaccccccgagaatgaccttgaacaatgaacggcccttcatgctgctg
ccgcccctcatggagtggatgcgcgtggccatcacctacgcagagcaccgccgcagcctc
accgtggacagcggcgacatccggcaggcagcccggctgctgctgcctggtctggactgt
gaacctcggcagctcaaacccgaacactgtttcagttccttccggaggctggatgcccga
gcagctactgaaaaattcaaccaggacctgggtttccgcatgctcaactgtgggaggacg
gacctcatcaaccaagccatcgaggccttgggtccggatggggttaacaccatggatgac
cagggtatgacgccactgatgtacgcctgcgctgctggggacgaagcgatggtccagatg
ttgattgatgctggggcaaacttggacatccaggttccaagcaactcccccaggcaccct
tccatccaccccgacagccggcactggacctcactgacattcgctgtgctgcatggacac
atctctgtggtccagttgctgctggatgctggtgcccatgtcgagggctcggcagtgaac
ggcggcgaggacagctatgcggagacgcccctgcagctggcctctgcggcagggaactat
gagctggtcagtttgttgctgagccgaggcgccgaccccctcctcagcatgctggaggcc
cacggcatgggctcctccctccacgaggacatgaactgcttcagccactcagctgcccac
ggccacaggaacgtcctgaggaagctcctgacgcagccacagcaggctaaagcggacgtg
ctgtccctggaggagatcctggccgagggtgtggaggaaagtgatgcgtcgagccagggc
agtggcagcgaggggcccgtgcggctgagccggacccgcaccaaggccctacaggaggcc
atgtactacagcgctgagcacggctacgtggacatcaccatggagctgagggcactggga
gtcccctggaagctgcacatctggatcgagtctctgaggacctcgttctcgcagtcgcgg
tactcggtggtgcagagcctcctgcgggacttcagctccatcagagaggaggagtacaac
gaggagctggtgaccgagggcttgcagctcatgttcgacatcctcaagaccagcaaaaac
gactccgtcatccagcaactggctaccatcttcacccactgctatggcagcagtcccatc
cccagcatcccagagatccggaagaccctgccggccaggctagatccacactttttgaac
aataaggagatgtcagatgtgaccttcctggtggaaggaaagctgttttatgcacataaa
gtcctgctggtgacagcttctaacaggttcaagacactaatgaccaataaatcagaacag
gatggggacagcagcaagaccatcgagatcagcgacatgaagtaccacatttttcagatg
atgatgcagtatctgtactacggaggaacagaatccatggagatccccaccactgacatc
ctggagctgctgtcagctgccagcctgttccagctggatgccctgcagaggcactgcgag
atcctgtgctcccagaccctcagcatggagagtgccgtgaacacctacaaatatgccaag
atccacaatgccccagaactggccctgttctgtgagggcttcttcctcaagcacatgaag
gccctactggagcaggatgccttccggcagctcatctacggccgcagcagcaaagtgcag
ggcctggatccactgcaggacctgcagaacaccctggcagagcgcgtgcactctgtctac
atcacctcccgggtgtga

DBGET integrated database retrieval system