KEGG   Homo sapiens (human): 25842Help
Entry
25842             CDS       T01001                                 

Gene name
ASF1A, CGI-98, CIA, HSPC146
Definition
(RefSeq) anti-silencing function 1A histone chaperone
  KO
K10753  
histone chaperone ASF1
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     25842 (ASF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y294(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
6q22.31
AA seq 204 aa AA seqDB search
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSV
LVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTET
ELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALP
SASKGWSTSENSLNVMLESHMDCM
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggttcaggtgaacaatgtagtggtgctggataacccttctcctttctacaac
ccgttccagttcgagatcaccttcgagtgcatcgaggacctgtctgaagacttggaatgg
aaaattatctatgtgggctctgcagaaagtgaagaatacgatcaagttttagactctgtt
ttagtgggtcctgttcccgcaggaaggcatatgtttgtatttcaggctgatgcacctaat
ccaggactcattccagatgcagatgcagtaggcgtaactgttgtgctaattacttgtacc
tatcgaggacaagaatttattagagttggctattatgtaaataatgaatatactgagaca
gaattaagggaaaatccaccagtaaaaccagacttttctaagcttcaaaggaatattttg
gcatctaatcccagggtcacaagattccacattaattgggaagataacacagaaaaactg
gaagatgcagagagcagtaatccaaatctacagtcacttctttcaacagatgcattacct
tcagcatcaaagggatggtccacatcagaaaactcactaaatgtcatgttagaatcccac
atggactgcatgtga

DBGET integrated database retrieval system