KEGG   Homo sapiens (human): 25847Help
Entry
25847             CDS       T01001                                 

Gene name
ANAPC13, APC13, SWM1
Definition
anaphase promoting complex subunit 13
Orthology
K12456  
anaphase-promoting complex subunit 13
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:hsa04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q22.2
AA seq 74 aa AA seqDB search
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDL
ALQYLHENVPPIGN
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atggacagtgaggttcagagagatggaaggatcttggatttgattgatgatgcttggcga
gaagacaagctgccttatgaggatgtcgcaataccactgaatgagcttcctgaacctgaa
caagacaatggtggcaccacagaatctgtcaaagaacaagaaatgaagtggacagactta
gccttacagtacctccatgagaatgttccccccattggaaactga

DBGET integrated database retrieval system