KEGG   Homo sapiens (human): 25847Help
Entry
25847             CDS       T01001                                 

Gene name
ANAPC13, APC13, SWM1
Definition
anaphase promoting complex subunit 13
Orthology
K12456  
anaphase-promoting complex subunit 13
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    25847 (ANAPC13)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    25847 (ANAPC13)
   04114 Oocyte meiosis
    25847 (ANAPC13)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    25847 (ANAPC13)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     25847 (ANAPC13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q22.2
AA seq 74 aa AA seqDB search
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDL
ALQYLHENVPPIGN
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atggacagtgaggttcagagagatggaaggatcttggatttgattgatgatgcttggcga
gaagacaagctgccttatgaggatgtcgcaataccactgaatgagcttcctgaacctgaa
caagacaatggtggcaccacagaatctgtcaaagaacaagaaatgaagtggacagactta
gccttacagtacctccatgagaatgttccccccattggaaactga

DBGET integrated database retrieval system