KEGG   Homo sapiens (human): 25862Help
Entry
25862             CDS       T01001                                 

Gene name
USP49
Definition
ubiquitin specific peptidase 49 (EC:3.4.19.12)
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21
AA seq 688 aa AA seqDB search
MDRCKHVGRLRLAQDHSILNPQKWCCLECATTESVWACLKCSHVACGRYIEDHALKHFEE
TGHPLAMEVRDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQKQDTPVRRGRTLRSM
ASGEDVVLPQRAPQGQPQMLTALWYRRQRLLARTLRLWFEKSSRGQAKLEQRRQEEALER
KKEEARRRRREVKRRLLEELASTPPRKSARLLLHTPRDAGPAASRPAALPTSRRVPAATL
KLRRQPAMAPGVTGLRNLGNTCYMNSILQVLSHLQKFRECFLNLDPSKTEHLFPKATNGK
TQLSGKPTNSSATELSLRNDRAEACEREGFCWNGRASISRSLELIQNKEPSSKHISLCRE
LHTLFRVMWSGKWALVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLHKVQQELESEGT
TRRILIPFSQRKLTKQVLKVVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYH
CIEKGFVPLNQTECLLTEMLAKFTETEALEGRIYACDQCNSKRRKSNPKPLVLSEARKQL
MIYRLPQVLRLHLKRFRWSGRNHREKIGVHVVFDQVLTMEPYCCRDMLSSLDKETFAYDL
SAVVMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSKLNVCSVEEVCKTQAYILFYTQRTVQ
GNARISETHLQAQVQSSNNDEGRPQTFS
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggatagatgcaaacatgtagggcggttacggctcgcccaggaccactccatcctgaac
cctcagaagtggtgctgcttagagtgtgccaccaccgagtccgtgtgggcctgcctcaag
tgctcccacgtggcctgcggccgctatattgaggaccacgccctgaaacactttgaggag
acgggacacccgctagccatggaagtccgggatctctacgtgttctgttacctgtgcaag
gactacgtgctcaatgataacccagagggggacctgaagctgctaagaagctccctcctg
gcggtccggggccagaaacaggacacgccggtgagacgtgggcggacgctgcggtccatg
gcttcgggtgaggacgtggtcctgccgcagcgcgctcctcagggacagccgcagatgctc
acggctctgtggtaccggcgtcagcgcctgctggccaggacgctgcggctgtggttcgag
aagagctcccggggccaggcgaagctggagcagcggcggcaggaggaggccctggagcgc
aagaaggaggaggcgcggaggcggcggcgcgaggtgaaacggcggctgctggaggagctg
gccagcacccctccgcgcaagagtgcacggctgctcctgcacacgccccgcgacgcgggc
ccggctgcctcgcgccccgccgccctccctacctcacgcagagtgcccgccgccacactc
aagctgcgtcgccagccggccatggccccaggcgtcacgggcctgcgcaacctgggcaac
acctgctacatgaactccatcctccaggtgctcagccacctccagaagttccgagaatgt
ttcctcaaccttgacccttccaaaacggaacatctgtttcccaaagccaccaacgggaag
actcagctttctggcaagccaaccaacagctcggccacggagctgtccttgagaaatgac
agggccgaggcatgcgagcgggagggcttctgctggaacggcagggcctccattagtcgg
agtctggagctcatccagaacaaggagccgagttcaaagcacatttccctctgccgtgaa
ctgcacaccctcttccgagtcatgtggtccgggaagtgggccctagtgtcgcccttcgcc
atgctccactcagtgtggagcctgatccctgccttccgcggctacgaccaacaggacgcg
caggaatttctctgcgagctgctgcacaaggtgcagcaggaactcgagtctgagggcacc
acacgccggatcctcatccccttctcccagaggaagctcaccaaacaggtcttaaaggtg
gtgaataccatatttcatgggcagctgctcagtcaggtcacatgtatatcatgcaattac
aaatccaataccattgagcccttttgggacctatccctggaattccctgaacgctatcac
tgcatagaaaaggggtttgtccctttgaatcaaacagagtgcttgctcactgagatgctg
gccaaattcacagagacagaggccctggaagggagaatctacgcttgtgaccagtgtaac
agcaaacgacgaaaatccaatcccaaaccccttgttctgagtgaagctagaaagcagtta
atgatctacagactacctcaggttctccggctgcaccttaaaagattcaggtggtctggc
cgtaatcatcgagagaagattggggtccatgtcgtctttgaccaggtattaaccatggaa
ccttactgctgcagggacatgctctcctctcttgacaaagagacctttgcctatgatctc
tccgcagtggtcatgcatcacgggaaagggtttggctcaggacactacacagcctattgc
tacaacacagagggaggtttttgggtccactgcaatgactcaaagctgaatgtatgcagt
gtcgaggaagtgtgcaaaacccaggcctacatccttttttacactcaaagaacagtgcag
ggcaatgcaagaatctcagaaacccatctccaagctcaggtgcagtccagcaacaatgat
gaaggcagaccacagacattttcctga

DBGET integrated database retrieval system