KEGG   Homo sapiens (human): 25898Help
Entry
25898             CDS       T01001                                 

Gene name
RCHY1, ARNIP, CHIMP, PIRH2, PRO1996, RNF199, ZNF363
Definition
ring finger and CHY zinc finger domain containing 1, E3 ubiquitin protein ligase
Orthology
K10144  
RING finger and CHY zinc finger domain-containing protein 1 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Ubiquitin mediated proteolysis
Measles
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q21.1
AA seq 252 aa AA seqDB search
MAATAREDGASGQERGQRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEV
QCINCEKIQHAQQTCEECSTLFGEYYCDICHLFDKDKKQYHCENCGICRIGPKEDFFHCL
KCNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRGYRCPLCMHS
ALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTA
QAGGRRISLDQQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacggcccgggaagatggcgccagcggtcaagagcgaggtcagcggggctgc
gagcactatgacagaggatgtctcctaaaggcaccttgctgtgacaagctttatacttgc
cgcttgtgtcatgataacaatgaagatcatcaactagatcgctttaaagtgaaggaagtg
cagtgcataaactgtgaaaaaattcaacatgcccaacagacttgtgaagaatgtagcaca
ttgtttggagaatattattgcgatatatgccatttgtttgacaaagataagaagcagtat
cactgtgaaaactgtggaatttgtaggattggtccaaaggaagattttttccattgtttg
aaatgtaacttatgcctagctatgaatcttcaaggaagacacaagtgtattgaaaatgtg
tcccgacagaattgtccaatatgtttggaggacattcacacatcccgtgttgttgctcat
gtcttgccatgtggacatcttttacatagaggctacagatgtccattatgtatgcactct
gctttagatatgaccaggtattggagacagctggatgatgaagtagcacagactcctatg
ccatcagaatatcagaacatgactgtggatattctctgcaatgactgtaatggacgatcc
actgttcagtttcatatattaggcatgaaatgtaagatttgtgaatcctataatactgct
caagctggaggacgtagaatttcactggatcagcaatga

DBGET integrated database retrieval system