KEGG   Homo sapiens (human): 2590Help
Entry
2590              CDS       T01001                                 

Gene name
GALNT2, GalNAc-T2
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 2
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00512  Mucin type O-glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    2590 (GALNT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     2590 (GALNT2)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  Mucin-type
   2590 (GALNT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C Glyco_tranf_2_2 CDtoxinA
Motif
Other DBs
NCBI-GeneID: 2590
NCBI-ProteinID: NP_004472
OMIM: 602274
HGNC: 4124
Ensembl: ENSG00000143641
Vega: OTTHUMG00000037771
Pharos: Q10471(Tbio)
UniProt: Q10471 A0A1L7NY50
Structure
PDB: 

Jmol
Position
1q42.13
AA seq 571 aa AA seqDB search
MRRRSRMLLCFAFLWVLGIAYYMYSGGGSALAGGAGGGAGRKEDWNEIDPIKKKDLHHSN
GEEKAQSMETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPD
TRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSND
PEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLER
VAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAP
IKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHV
FRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKK
LSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQ
EWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCL
DSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggcgctcgcggatgctgctctgcttcgccttcctgtgggtgctgggcatcgcc
tactacatgtactcggggggcggctctgcgctggccgggggcgcgggcggcggcgccggc
aggaaggaggactggaatgaaattgaccccattaaaaagaaagaccttcatcacagcaat
ggagaagagaaagcacaaagcatggagaccctccctccagggaaagtacggtggccagac
tttaaccaggaagcttatgttggagggacgatggtccgctccgggcaggacccttacgcc
cgcaacaagttcaaccaggtggagagtgataagcttcgaatggacagagccatccctgac
acccggcatgaccagtgtcagcggaagcagtggcgggtggatctgccggccaccagcgtg
gtgatcacgtttcacaatgaagccaggtcggccctactcaggaccgtggtcagcgtgctt
aagaaaagcccgccccatctcataaaagaaatcatcttggtggatgactacagcaatgat
cctgaggacggggctctcttggggaaaattgagaaagtgcgagttcttagaaatgatcga
cgagaaggcctcatgcgctcacgggttcggggggccgatgctgcccaagccaaggtcctg
accttcctggacagtcactgcgagtgtaatgagcactggctggagcccctcctggaaagg
gtggcggaggacaggactcgggttgtgtcacccatcatcgatgtcattaatatggacaac
tttcagtatgtgggggcatctgctgacttgaagggcggttttgattggaacttggtattc
aagtgggattacatgacgcctgagcagagaaggtcccggcaggggaacccagtcgcccct
ataaaaacccccatgattgctggtgggctgtttgtgatggataagttctattttgaagaa
ctggggaagtacgacatgatgatggatgtgtggggaggagagaacctagagatctcgttc
cgcgtgtggcagtgtggtggcagcctggagatcatcccgtgcagccgtgtgggacacgtg
ttccggaagcagcacccctacacgttcccgggtggcagtggcactgtctttgcccgaaac
acccgccgggcagcagaggtctggatggatgaatacaaaaatttctattatgcagcagtg
ccttctgctagaaacgttccttatggaaatattcagagcagattggagcttaggaagaaa
ctcagctgcaagcctttcaaatggtaccttgaaaatgtctatccagagttaagggttcca
gaccatcaggatatagcttttggggccttgcagcagggaactaactgcctcgacactttg
ggacactttgctgatggtgtggttggagtttatgaatgtcacaatgctgggggaaaccag
gaatgggccttgacgaaggagaagtcggtgaagcacatggatttgtgccttactgtggtg
gaccgggcaccgggctctcttataaagctgcagggctgccgagaaaatgacagcagacag
aaatgggaacagatcgagggcaactccaagctgaggcacgtgggcagcaacctgtgcctg
gacagtcgcacggccaagagcgggggcctaagcgtggaggtgtgtggcccggccctttcg
cagcagtggaagttcacgctcaacctgcagcagtag

DBGET integrated database retrieval system