KEGG   Homo sapiens (human): 25904Help
Entry
25904             CDS       T01001                                 

Gene name
CNOT10
Definition
CCR4-NOT transcription complex, subunit 10
Orthology
K12607  
CCR4-NOT transcription complex subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    25904 (CNOT10)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     25904 (CNOT10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p22.3
AA seq 717 aa AA seqDB search
MAADKPADQGAEKHEGTGQSSGITDQEKELSTNAFQAFTSGNYDACLQHLACLQDINKDD
YKIILNTAVAEFFKSNQTTTDNLRQTLNQLKNQVHSAVEEMDGLDDVENSMLYYNQAVIL
YHLRQYTEAISVGEKLYQFIEPFEEKFAQAVCFLLVDLYILTYQAEKALHLLAVLEKMIS
QGNNNKNGKNETGNNNNKDGSNHKAESGALIEAAKSKIHQYKVRAYIQMKSLKACKREIK
SVMNTAGNSAPSLFLKSNFEYLRGNYRKAVKLLNSSNIAEHPGFMKTGECLRCMFWNNLG
CIHFAMSKHNLGIFYFKKALQENDNVCAQLSAGSTDPGKKFSGRPMCTLLTNKRYELLYN
CGIQLLHIGRPLAAFECLIEAVQVYHANPRLWLRLAECCIAANKGTSEQETKGLPSKKGI
VQSIVGQGYHRKIVLASQSIQNTVYNDGQSSAIPVASMEFAAICLRNALLLLPEEQQDPK
QENGAKNSNQLGGNTESSESSETCRCSILACSAYVALALGDNLMALNHADKLLQQPKLSG
SLKFLGHLYAAEALISLDRISDAITHLNPENVTDVSLGISSNEQDQGSDKGENEAMESSG
KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAILLAV
YLELQNGNTQLALQIIKRNQLLPAVKTHSEVRKKPVFQPVHPIQPIQMPAFTTVQRK
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagacaagcctgcagatcagggagcagagaaacatgaaggcacaggtcagtcc
tctgggatcactgatcaagagaaggagttatccaccaatgctttccaagctttcacatct
ggaaattatgatgcctgtctacaacaccttgcctgtctacaagatataaacaaagatgat
tataaaataattttgaatacagcagtagctgagttttttaaaagtaaccaaacaacaaca
gataatttgagacaaacacttaaccagctgaagaatcaggtccactcagctgttgaagaa
atggatggattagatgatgttgaaaacagcatgttgtactataatcaagcagtcattctt
tatcatctgcggcagtatacagaagccatatcagttggtgaaaaactttatcagttcata
gagccttttgaagaaaaatttgcccaagcagtgtgttttttgcttgtagacctgtatata
ttaacctaccaagctgagaaagctttgcatcttcttgctgtcctagaaaaaatgatttca
cagggtaacaataacaaaaatggaaagaatgagactggtaataacaacaacaaagatgga
tctaatcataaagctgaaagtggagctctaatagaagctgcaaaatcaaagatacatcag
tacaaagtacgagcttatatccaaatgaagtctctgaaagcatgtaaaagggaaatcaag
tcagtcatgaatacagctggaaattccgcaccctctctctttcttaaaagcaattttgag
tacttaagaggtaattatcgaaaagccgtgaagctattaaatagttcaaacattgctgag
catccaggattcatgaaaacaggtgaatgcttgagatgcatgttctggaataaccttggt
tgcatccattttgccatgagcaagcacaatttgggaatattctactttaaaaaggctctg
caagagaatgacaatgtctgtgcacagctcagtgcaggtagcactgatccaggtaaaaaa
ttttcaggaagacccatgtgtacgttactaaccaataagagatatgagttgctgtataac
tgtggaattcagcttcttcacattggaaggcctcttgctgccttcgaatgtctgattgaa
gctgttcaggtttatcatgcaaatcctcgcctctggctacggctggctgaatgctgcatt
gctgccaataaggggacttctgaacaagaaactaaaggccttcccagcaaaaaaggaatt
gtacagtctattgttggtcaaggctatcatcgtaaaatagttttggcatcacagtctata
cagaatactgtttataatgatgggcagtcttcggccattcctgtagccagtatggagttt
gcagccatatgtctcagaaatgccttgttgctgctacctgaagaacagcaagatccaaag
caggaaaatggggctaaaaatagtaatcaattaggtgggaacacagagagcagcgaaagc
agtgaaacttgcaggtgctccatacttgcttgcagtgcctacgtggctctggctttgggt
gataacctcatggctttgaatcatgcagataaacttcttcagcagcccaagctgtcagga
tctcttaagtttttgggacatttatatgctgcagaagccctcatctctctcgacagaata
tctgatgccattactcacttgaacccggagaatgtcactgatgtctccttagggatctct
tcaaatgagcaggaccaaggatcagacaaaggtgaaaatgaagcaatggaatcctctggt
aagcgggcccctcagtgctaccccagttccgtcaactctgccaggactgtgatgctgttc
aaccttggcagcgcttactgcctgaggagcgaatatgacaaagcccgaaagtgtctccac
caggcggcttcaatgatccatcctaaagaggtgccccctgaggccatcttgctggcagtc
taccttgaactgcagaatggtaatactcagctggccttacagatcatcaaaaggaatcag
ctgctccctgcagtgaaaacacactctgaagtgagaaagaagccagtgtttcagcctgtc
cacccgatccagcccatccaaatgccggctttcaccactgtgcagagaaagtga

DBGET integrated database retrieval system