KEGG   Homo sapiens (human): 259285Help
Entry
259285            CDS       T01001                                 

Gene name
TAS2R39, T2R39, T2R57
Definition
taste receptor, type 2, member 39
Orthology
K08474  
taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Class
Organismal Systems; Sensory system; Taste transduction [PATH:hsa04742]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q34
AA seq 338 aa AA seqDB search
MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHA
AEWVQNKAVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFL
NFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINIC
TVYCNNSFPIHSSNSTKKTYLSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTL
HMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFIYLSNMFDINSLWNNLCQIIM
AAYPASHSILLIQDNPGLRRAWKRLQLRLHLYPKEWTL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctagggagatgttttcctccagacaccaaagagaagcaacagctcagaatgactaaa
ctctgcgatcctgcagaaagtgaattgtcgccatttctcatcaccttaattttagcagtt
ttacttgctgaatacctcattggtatcattgcaaatggtttcatcatggctatacatgca
gctgaatgggttcaaaataaggcagtttccacaagtggcaggatcctggttttcctgagt
gtatccagaatagctctccaaagcctcatgatgttagaaattaccatcagctcaacctcc
ctaagtttttattctgaagacgctgtatattatgcattcaaaataagttttatattctta
aatttttgtagcctgtggtttgctgcctggctcagtttcttctactttgtgaagattgcc
aatttctcctacccccttttcctcaaactgaggtggagaattactggattgataccctgg
cttctgtggctgtccgtgtttatttccttcagtcacagcatgttctgcatcaacatctgc
actgtgtattgtaacaattctttccctatccactcctccaactccactaagaaaacatac
ttgtctgagatcaatgtggtcggtctggcttttttctttaacctggggattgtgactcct
ctgatcatgttcatcctgacagccaccctgctgatcctctctctcaagagacacacccta
cacatgggaagcaatgccacagggtccaacgaccccagcatggaggctcacatgggggcc
atcaaagctatcagctactttctcattctctacattttcaatgcagttgctctgtttatc
tacctgtccaacatgtttgacatcaacagtctgtggaataatttgtgccagatcatcatg
gctgcctaccctgccagccactcaattctactgattcaagataaccctgggctgagaaga
gcctggaagcggcttcagcttcgacttcatctttacccaaaagagtggactctgtga

DBGET integrated database retrieval system