KEGG   Homo sapiens (human): 259292Help
Entry
259292            CDS       T01001                                 

Gene name
TAS2R46, T2R46, T2R54
Definition
taste receptor, type 2, member 46
Orthology
K08474  
taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    259292 (TAS2R46)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste type 2
    259292 (TAS2R46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13.2
AA seq 309 aa AA seqDB search
MITFLPIIFSILIVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLW
VLVLNWYATELNPAFNSIEVRITAYNVWAVINHFSNWLATSLSIFYLLKIANFSNLIFLH
LKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNTTVT
ILANLVPFTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSMKVHIKALQTVTSFLLLCAI
YFLSIIMSVWSFESLENKPVFMFCEAIAFSYPSTHPFILIWGNKKLKQTFLSVLWHVRYW
VKGEKPSSS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgataacttttctgcccatcattttttccattctaatagtggttacatttgtgattgga
aattttgctaatggcttcatagcattggtaaattccattgagtggttcaagagacaaaag
atctcttttgctgaccaaattctcactgctctggcagtctccagagttggtttactctgg
gtattagtattaaattggtatgcaactgagttgaatccagcttttaacagtatagaagta
agaattactgcttacaatgtctgggcagtaatcaaccatttcagcaactggcttgctact
agcctcagcatattttatttgctcaagattgccaatttctccaaccttatttttcttcac
ttaaagaggagagttaagagtgttgttctggtgatactattggggcctttgctatttttg
gtttgtcatctttttgtgataaacatgaatcagattatatggacaaaagaatatgaagga
aacatgacttggaagatcaaactgaggagtgcaatgtacctttcaaatacaacggtaacc
atcctagcaaacttagttcccttcactctgaccctgatatcttttctgctgttaatctgt
tctctgtgtaaacatctcaaaaagatgcagctccatggcaaaggatctcaagatcccagc
atgaaggtccacataaaagctttgcaaactgtgacctccttcctcttgttatgtgccatt
tactttctgtccataatcatgtcagtttggagttttgagagtctggaaaacaaacctgtc
ttcatgttctgcgaagctattgcattcagctatccttcaacccacccattcatcctgatt
tggggaaacaagaagctaaagcagacttttctttcagttttgtggcatgtgaggtactgg
gtgaaaggagagaagccttcatcttcatag

DBGET integrated database retrieval system