KEGG   Homo sapiens (human): 25930Help
Entry
25930             CDS       T01001                                 

Gene name
PTPN23, HD-PTP, HDPTP, PTP-TD14
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 23 (EC:3.1.3.48)
  KO
K18040  
tyrosine-protein phosphatase non-receptor type 23 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     25930 (PTPN23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p21.3
AA seq 1510 aa AA seqDB search
MLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQ
ECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIY
YFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIG
GKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLVPMAAH
EASSLYSEEKAKLLREMMAKIEDKNEVLDQFMDSMQLDPETVDNLDAYSHIPPQLMEKCA
ALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQAGAISIT
SKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRAALPTPALS
PEDKAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDHSEMKKLFEEQL
KKYDQLKVYLEQNLAAQDRVLCALTEANVQYAAVRRVLSDLDQKWNSTLQTLVASYEAYE
DLMKKSQEGRDFYADLESKVAALLERTQSTCQAREAARQQLLDRELKKKPPPRPTAPKPL
LPRREESEAVEAGDPPEELRSLPPDMVAGPRLPDTFLGSATPLHFPPSPFPSSTGPGPHY
LSGPLPPGTYSGPTQLIQPRAPGPHAMPVAPGPALYPAPAYTPELGLVPRSSPQHGVVSS
PYVGVGPAPPVAGLPSAPPPQFSGPELAMAVRPATTTVDSIQAPIPSHTAPRPNPTPAPP
PPCFPVPPPQPLPTPYTYPAGAKQPIPAQHHFSSGIPAGFPAPRIGPQPQPHPQPHPSQA
FGPQPPQQPLPLQHPHLFPPQAPGLLPPQSPYPYAPQPGVLGQPPPPLHTQLYPGPAQDP
LPAHSGALPFPSPGPPQPPHPPLAYGPAPSTRPMGPQAAPLTIRGPSSAGQSTPSPHLVP
SPAPSPGPGPVPPRPPAAEPPPCLRRGAAAADLLSSSPESQHGGTQSPGGGQPLLQPTKV
DAAEGRRPQALRLIERDPYEHPERLRQLQQELEAFRGQLGDVGALDTVWRELQDAQEHDA
RGRSIAIARCYSLKNRHQDVMPYDSNRVVLRSGKDDYINASCVEGLSPYCPPLVATQAPL
PGTAADFWLMVHEQKVSVIVMLVSEAEMEKQKVARYFPTERGQPMVHGALSLALSSVRST
ETHVERVLSLQFRDQSLKRSLVHLHFPTWPELGLPDSPSNLLRFIQEVHAHYLHQRPLHT
PIIVHCSSGVGRTGAFALLYAAVQEVEAGNGIPELPQLVRRMRQQRKHMLQEKLHLRFCY
EAVVRHVEQVLQRHGVPPPCKPLASASISQKNHLPQDSQDLVLGGDVPISSIQATIAKLS
IRPPGGLESPVASLPGPAEPPGLPPASLPESTPIPSSSPPPLSSPLPEAPQPKEEPPVPE
APSSGPPSSSLELLASLTPEAFSLDSSLRGKQRMSKHNFLQAHNGQGLRATRPSDDPLSL
LDPLWTLNKT
NT seq 4533 nt NT seq  +upstreamnt  +downstreamnt
atgctgggggccatggacaagcgggtgtctgaggagggcatgaaggtctcctgtacccat
ttccagtgcgcagccggcgccttcgcctacctacgggagcacttccctcaagcctacagc
gtcgacatgagccgccagatccttacgctcaacgtcaacctcatgctgggccaggctcag
gagtgcctcctggagaagtcgatgttggacaacaggaagagctttctggtggcccgcatc
agtgcacaggtggtagattactacaaggaggcatgccgggccttggagaaccccgacact
gcctcactgctgggccggatccagaaggactggaagaaacttgtgcagatgaagatctac
tacttcgcagccgtggctcatctgcacatgggaaagcaggccgaggagcagcagaagttc
ggggagcgggttgcatacttccagagcgccctggacaagctcaatgaagccatcaagttg
gccaagggccagcctgacactgtgcaagacgcgcttcgcttcactatggatgtcattggg
ggaaagtacaattctgccaagaaggacaacgacttcatttaccatgaggctgtcccagca
ttggacactcttcagcctgtaaaaggagcccccttggtgaagcccttgccagtgaacccc
acagacccagctgttacaggccctgacatctttgccaaactggtacccatggctgcccac
gaggcctcgtcactgtacagtgaggagaaggccaagctgctccgggagatgatggccaag
attgaggacaagaatgaggtcctggaccagttcatggattcaatgcagttggatcccgag
acggtggacaaccttgatgcctacagccacatcccaccccagctcatggagaagtgcgcg
gctctcagcgtccggcccgacactgtcaggaaccttgtacagtccatgcaagtgctgtca
ggtgtgttcacggatgtggaggcttccctgaaggacatcagagatctgttggaggaggat
gagctgctagagcagaagtttcaggaggcggtgggccaggcaggggccatctccatcacc
tccaaggctgagctggcagaggtgaggcgagaatgggccaagtacatggaagtccatgag
aaggcctccttcaccaacagtgagctgcaccgtgccatgaacctgcacgtcggcaacctg
cgcctgctcagcgggccgcttgaccaggtccgggctgccctgcccacaccggccctctcc
ccagaggacaaggccgtgctgcaaaacctaaagcgcatcctggctaaggtgcaggagatg
cgggaccagcgcgtgtccctggagcagcagctgcgtgagcttatccagaaagatgacatc
actgcctcgctggtcaccacagaccactcagagatgaagaagttgttcgaggagcagctg
aaaaagtatgaccagctgaaggtgtacctggagcagaacctggccgcccaggaccgtgtc
ctctgtgcactgacagaggccaacgtgcagtacgcagccgtgcggcgggtactcagcgac
ttggaccaaaagtggaactccacgctgcagaccctggtggcctcgtatgaagcctatgag
gacctgatgaagaagtcgcaggagggcagggacttctacgcagatctggagagcaaggtg
gctgctctgctggagcgcacgcagtccacctgccaggcccgcgaggctgcccgccagcag
ctcctggacagggagctgaagaagaagccgccgccacggcccacagccccaaagccgctg
ctgccccgcagggaggagagtgaggcagtggaagcaggagacccccctgaggagctgcgc
agcctcccccctgacatggtggctggcccacgactgcctgacaccttcctgggaagtgcc
accccgctccactttcctcccagccccttccccagctccacaggcccaggaccccactat
ctctcaggccccttgccccctggtacctactcgggccccacccagctgatacagcccagg
gccccagggccccatgcaatgcccgtagcacctgggcctgccctctacccagcccctgcc
tacacaccggagctgggccttgtgccccgatcctccccacagcatggcgtggtgagcagt
ccctatgtgggggtagggccggccccaccagttgcaggtctcccctcggccccacctcct
caattctcaggccccgagttggccatggcggttcggccagccaccaccacagtagatagc
atccaggcgcccatccccagccacacagccccacggccaaaccccacccctgctcctccc
ccgccctgcttccctgtgcccccaccgcagccactgcccacgccttacacctaccctgca
ggggctaagcaacccatcccggcacagcaccacttctcttctgggatccccgcaggtttt
ccagccccaaggattgggccccagccccagccccatcctcagccccatccttcacaagcg
tttgggcctcagcccccacagcagccccttccactccagcatccacatctcttcccaccc
caggccccaggactcctacccccacaatccccctacccctatgcccctcagcctggggtc
ctggggcagccgccaccccccctacacacccagctctacccaggtcccgctcaagaccct
ctgccagcccactcaggggctctgcctttccccagccctgggccccctcagcctccccat
cccccactggcatatggtcctgccccttctaccagacccatgggcccccaggcagcccct
cttaccattcgagggccctcgtctgctggccagtccacccctagtccccacctggtgcct
tcacctgccccatctccagggcctggtccggtaccccctcgccccccagcagcagaacca
cccccttgcctgcgccgaggcgccgcagctgcagacctgctctcctccagcccggagagc
cagcatggcggcactcagtctcctgggggtgggcagcccctgctgcagcccaccaaggtg
gatgcagctgagggtcgtcggccgcaggccctgcggctgattgagcgggacccctatgag
catcctgagaggctgcggcagttgcagcaggagctggaggcctttcggggtcagctgggg
gatgtgggagctctggacactgtctggcgagagctgcaagatgcgcaggaacatgatgcc
cgaggccgttccatcgccattgcccgctgctactcactgaagaaccggcaccaggatgtc
atgccctatgacagtaaccgtgtggtgctgcgctcaggcaaggatgactacatcaatgcc
agctgcgtggaggggctctccccatactgccccccgctagtggcaacccaggccccactg
cctggcacagctgctgacttctggctcatggtccatgagcagaaagtgtcagtcattgtc
atgctggtttctgaggctgagatggagaagcaaaaagtggcacgctacttccccaccgag
aggggccagcccatggtgcacggtgccctgagcctggcattgagcagcgtccgcagcacc
gaaacccatgtggagcgcgtgctgagcctgcagttccgagaccagagcctcaagcgctct
cttgtgcacctgcacttccccacttggcctgagttaggcctgcccgacagccccagcaac
ttgctgcgcttcatccaggaggtgcacgcacattacctgcatcagcggccgctgcacacg
cccatcattgtgcactgcagctctggtgtgggccgcacgggagcctttgcactgctctat
gcagctgtgcaggaggtggaggctgggaacggaatccctgagctgcctcagctggtgcgg
cgcatgcggcagcagagaaagcacatgctgcaggagaagctgcacctcaggttctgctat
gaggcagtggtgagacacgtggagcaggtcctgcagcgccatggtgtgcctcctccatgc
aaacccttggccagtgcaagcatcagccagaagaaccaccttcctcaggactcccaggac
ctggtcctcggtggggatgtgcccatcagctccatccaggccaccattgccaagctcagc
attcggcctcctggggggttggagtccccggttgccagcttgccaggccctgcagagccc
ccaggcctcccgccagccagcctcccagagtctaccccaatcccatcttcctccccgccc
cccctttcctccccactacctgaggctccccagcctaaggaggagccgccagtgcctgaa
gcccccagctcggggcccccctcctcctccctggaattgctggcctccttgaccccagag
gccttctccctggacagctccctgcggggcaaacagcggatgagcaagcataactttctg
caggcccataacgggcaagggctgcgggccacccggccctctgacgaccccctcagcctt
ctggatccactctggacactcaacaagacctga

DBGET integrated database retrieval system