KEGG   Homo sapiens (human): 25942Help
Entry
25942             CDS       T01001                                 

Gene name
SIN3A
Definition
(RefSeq) SIN3 transcription regulator family member A
  KO
K11644  
paired amphipathic helix protein Sin3a
Organism
hsa  Homo sapiens (human)
Pathway
Thyroid hormone signaling pathway
Huntington's disease
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    25942 (SIN3A)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    25942 (SIN3A)
  Neurodegenerative diseases
   05016 Huntington's disease
    25942 (SIN3A)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     25942 (SIN3A)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    25942 (SIN3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24.2
AA seq 1273 aa AA seqDB search
MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTP
SYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQR
LKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIM
GFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQ
PAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQ
PVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYA
QVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRP
SQNGCQIRRHPTGTTPPVKKKPKLLNLKDSSMADASKHGGGTESLFFDKVRKALRSAEAY
ENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETYPKERATE
GIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSS
KKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGT
SEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQ
NEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLA
YEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEE
EMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQ
ILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYP
AFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQV
TDLYLAENNNGATGGQLNTQNSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTIE
LLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGR
EQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHE
RVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSIN
KYRVKYGTVFKAP
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcgtttggatgaccaggagtcaccggtgtatgcagcccagcagcgtcggatc
cctggcagcacagaggcttttcctcaccagcaccgggtgcttgcccctgcccctcctgtg
tatgaagcagtgtctgagaccatgcagtcagctacgggaattcagtactctgtaacaccc
agctaccaggtttcagccatgccacagagctccggcagtcatgggcccgctatagcagca
gttcatagcagccatcatcacccaacagcggtgcagccccacggaggccaggtggtccag
agtcatgctcatccagccccaccagttgcaccagtgcagggacagcagcaatttcagagg
ctgaaggtggaggatgcgctatcttatcttgaccaggtgaagctgcagtttggtagtcag
cctcaggtctacaatgatttccttgacatcatgaaggaatttaaatctcagagcatcgac
accccaggagtgattagtcgtgtgtcccagctattcaaaggccaccccgatctgataatg
ggattcaacaccttcttgccccctggctacaaaattgaggtgcaaaccaatgacatggtg
aatgtgacaactcctggccaggttcatcagattcccacccatggcatccagccacagcct
caaccaccaccccaacatccttcccagccttcagcccagtcagccccagctcctgcccag
ccagctcctcagcccccacctgccaaagtcagcaagccctcccaactgcaagcacatact
ccggccagtcagcagactcccccacttccaccgtatgcatccccacgttctccgccggtc
cagcctcacacaccagtgacaatctcgttgggaacggccccatccttgcagaacaatcaa
cctgtggagtttaatcatgccatcaactatgttaataagatcaagaacagatttcagggc
caaccagacatctacaaagcattcctggagattttgcacacatatcagaaagagcagaga
aatgccaaggaagctggaggaaactacactccagcattgacagagcaggaggtgtatgcc
caggttgctcgtctctttaaaaaccaggaagatttgttgtcagagtttggacaattccta
ccagatgccaacagctccgtgcttttaagcaaaacaactgctgagaaggttgattctgtg
agaaatgatcatggaggcactgtcaagaagccccaactgaacaacaagccgcagaggccc
agccagaatggctgccagatccgcagacatcctacaggaaccacccctccagttaagaag
aaacccaaactgctcaatctgaaggattcttctatggcagatgccagcaaacatggtggt
ggaacagaatcgttattttttgataaggtccgaaaggctcttcggagtgcagaagcctac
gaaaatttcctacgctgtcttgttatttttaaccaggaggtgatctctcgtgctgagctt
gtgcaactagtctctcctttcctggggaaattccctgagttgtttaattggtttaaaaac
tttctgggctataaggagtctgtacatctggaaacttatccaaaggagcgagccacagag
ggcattgctatggagatagattatgcttcttgtaaacgattgggctccagctatcgagcc
ttaccaaagagttaccagcagcccaagtgtacaggacggactcctctctgtaaagaggtt
ttaaatgatacctgggtttccttcccttcgtggtctgaggactctacctttgtgagttcc
aagaagactcaatatgaagaacatatttatcgttgtgaagatgaacgctttgagcttgat
gtagttttagagaccaatctggcaacaatccgggttctggaagcaatacagaagaagctt
tcccgcttgtctgctgaagaacaagccaaatttcgcttggacaacacccttgggggcaca
tcagaagtcatccatagaaaagcactccagaggatatatgctgataaagcagctgacatc
attgatggtctgagaaagaatccctccattgctgttccaattgtccttaaaaggttgaag
atgaaagaggaagaatggcgagaagctcagagaggctttaacaaagtatggcgagaacaa
aatgagaaatactacttgaagtctctggaccaccaggggatcaactttaaacagaatgac
accaaggtcctgaggtctaagagcttactcaatgagattgagagtatctatgatgagagg
caagagcaggctacggaggagaatgctggtgtacctgttggcccacacctctcacttgcg
tatgaagacaaacaaatactggaagatgctgctgctctgattatccaccatgtgaagagg
cagacaggcattcagaaggaggacaaatataagataaaacaaatcatgcatcattttatt
ccagatttgctctttgcccaaagaggtgatctctcagatgtggaggaagaggaagaagaa
gagatggatgtagatgaagccacaggggcagttaagaagcacaatggtgttgggggcagt
ccccctaagtccaagttactgtttagtaacacagcagctcaaaaattaagaggaatggat
gaagtatacaacctcttctatgtcaacaacaactggtatatttttatgcgactgcaccag
attctctgcctgaggctgctacggatttgttcccaagccgaacggcaaattgaagaagaa
aaccgagagagagaatgggaacgggaagtgctgggcataaagcgagacaagagtgacagc
cctgccattcagctacgtctcaaagaacctatggatgttgatgtagaagattattaccca
gctttcctggacatggtgcggagcctgctggatggcaacatagactcatcacagtatgaa
gattcactgagagagatgttcaccattcatgcctacattgcctttaccatggacaaactg
atccagagcattgtcagacagctgcagcatatcgtgagtgatgagatctgtgtgcaggtg
actgacctttacctggcagaaaataataatggggccaccggaggccagctgaacacacag
aactcaaggagcctcctggagtcaacgtatcagcggaaagctgagcagctaatgtcagat
gagaattgctttaagcttatgtttattcagagccaaggccaggtccagctgactattgag
cttctggacacagaagaggagaattcggatgaccctgtggaagcagagcgctggtcagac
tacgtggagcgatacatgaattcagatactacctcgcctgagcttcgtgaacatctagca
cagaaaccagtatttctccccaggaatctacggcggatccggaagtgtcaacgtggtcga
gagcagcaggaaaaggaagggaaggaaggaaacagcaagaagaccatggagaatgtggat
agtctggataagctggagtgtagattcaagctgaattcctacaagatggtgtatgtgatc
aaatcagaggactatatgtatcggaggaccgccctgctccgggctcatcagtcccatgag
cgtgtaagcaagcgtctacatcagagattccaggcctgggtagataaatggaccaaggag
catgtgccccgtgaaatggcagcagagaccagcaagtggctcatgggtgaggggctggag
ggcctggtgccctgtaccaccacctgtgatacagagaccctgcattttgtgagcattaac
aagtatcgtgtcaaatacggcacagtattcaaagccccttaa

DBGET integrated database retrieval system