KEGG   Homo sapiens (human): 25942Help
Entry
25942             CDS       T01001                                 

Gene name
SIN3A
Definition
SIN3 transcription regulator family member A
Orthology
K11644  
paired amphipathic helix protein Sin3a
Organism
hsa  Homo sapiens (human)
Pathway
Thyroid hormone signaling pathway
Huntington's disease
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    25942 (SIN3A)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    25942 (SIN3A)
  Neurodegenerative diseases
   05016 Huntington's disease
    25942 (SIN3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24.2
AA seq 1273 aa AA seqDB search
MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTP
SYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQR
LKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIM
GFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQ
PAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQ
PVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYA
QVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRP
SQNGCQIRRHPTGTTPPVKKKPKLLNLKDSSMADASKHGGGTESLFFDKVRKALRSAEAY
ENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETYPKERATE
GIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSS
KKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGT
SEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQ
NEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLA
YEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEE
EMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQ
ILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYP
AFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQV
TDLYLAENNNGATGGQLNTQNSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTIE
LLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGR
EQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHE
RVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSIN
KYRVKYGTVFKAP
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcgtttggatgaccaggagtcaccggtgtatgcagcccagcagcgtcggatc
cctggcagcacagaggcttttcctcaccagcaccgggtgcttgcccctgcccctcctgtg
tatgaagcagtgtctgagaccatgcagtcagctacgggaattcagtactctgtaacaccc
agctaccaggtttcagccatgccacagagctccggcagtcatgggcccgctatagcagca
gttcatagcagccatcatcacccaacagcggtgcagccccacggaggccaggtggtccag
agtcatgctcatccagccccaccagttgcaccagtgcagggacagcagcaatttcagagg
ctgaaggtggaggatgcgctatcttatcttgaccaggtgaagctgcagtttggtagtcag
cctcaggtctacaatgatttccttgacatcatgaaggaatttaaatctcagagcatcgac
accccaggagtgattagtcgtgtgtcccagctattcaaaggccaccccgatctgataatg
ggattcaacaccttcttgccccctggctacaaaattgaggtgcaaaccaatgacatggtg
aatgtgacaactcctggccaggttcatcagattcccacccatggcatccagccacagcct
caaccaccaccccaacatccttcccagccttcagcccagtcagccccagctcctgcccag
ccagctcctcagcccccacctgccaaagtcagcaagccctcccaactgcaagcacatact
ccggccagtcagcagactcccccacttccaccgtatgcatccccacgttctccgccggtc
cagcctcacacaccagtgacaatctcgttgggaacggccccatccttgcagaacaatcaa
cctgtggagtttaatcatgccatcaactatgttaataagatcaagaacagatttcagggc
caaccagacatctacaaagcattcctggagattttgcacacatatcagaaagagcagaga
aatgccaaggaagctggaggaaactacactccagcattgacagagcaggaggtgtatgcc
caggttgctcgtctctttaaaaaccaggaagatttgttgtcagagtttggacaattccta
ccagatgccaacagctccgtgcttttaagcaaaacaactgctgagaaggttgattctgtg
agaaatgatcatggaggcactgtcaagaagccccaactgaacaacaagccgcagaggccc
agccagaatggctgccagatccgcagacatcctacaggaaccacccctccagttaagaag
aaacccaaactgctcaatctgaaggattcttctatggcagatgccagcaaacatggtggt
ggaacagaatcgttattttttgataaggtccgaaaggctcttcggagtgcagaagcctac
gaaaatttcctacgctgtcttgttatttttaaccaggaggtgatctctcgtgctgagctt
gtgcaactagtctctcctttcctggggaaattccctgagttgtttaattggtttaaaaac
tttctgggctataaggagtctgtacatctggaaacttatccaaaggagcgagccacagag
ggcattgctatggagatagattatgcttcttgtaaacgattgggctccagctatcgagcc
ttaccaaagagttaccagcagcccaagtgtacaggacggactcctctctgtaaagaggtt
ttaaatgatacctgggtttccttcccttcgtggtctgaggactctacctttgtgagttcc
aagaagactcaatatgaagaacatatttatcgttgtgaagatgaacgctttgagcttgat
gtagttttagagaccaatctggcaacaatccgggttctggaagcaatacagaagaagctt
tcccgcttgtctgctgaagaacaagccaaatttcgcttggacaacacccttgggggcaca
tcagaagtcatccatagaaaagcactccagaggatatatgctgataaagcagctgacatc
attgatggtctgagaaagaatccctccattgctgttccaattgtccttaaaaggttgaag
atgaaagaggaagaatggcgagaagctcagagaggctttaacaaagtatggcgagaacaa
aatgagaaatactacttgaagtctctggaccaccaggggatcaactttaaacagaatgac
accaaggtcctgaggtctaagagcttactcaatgagattgagagtatctatgatgagagg
caagagcaggctacggaggagaatgctggtgtacctgttggcccacacctctcacttgcg
tatgaagacaaacaaatactggaagatgctgctgctctgattatccaccatgtgaagagg
cagacaggcattcagaaggaggacaaatataagataaaacaaatcatgcatcattttatt
ccagatttgctctttgcccaaagaggtgatctctcagatgtggaggaagaggaagaagaa
gagatggatgtagatgaagccacaggggcagttaagaagcacaatggtgttgggggcagt
ccccctaagtccaagttactgtttagtaacacagcagctcaaaaattaagaggaatggat
gaagtatacaacctcttctatgtcaacaacaactggtatatttttatgcgactgcaccag
attctctgcctgaggctgctacggatttgttcccaagccgaacggcaaattgaagaagaa
aaccgagagagagaatgggaacgggaagtgctgggcataaagcgagacaagagtgacagc
cctgccattcagctacgtctcaaagaacctatggatgttgatgtagaagattattaccca
gctttcctggacatggtgcggagcctgctggatggcaacatagactcatcacagtatgaa
gattcactgagagagatgttcaccattcatgcctacattgcctttaccatggacaaactg
atccagagcattgtcagacagctgcagcatatcgtgagtgatgagatctgtgtgcaggtg
actgacctttacctggcagaaaataataatggggccaccggaggccagctgaacacacag
aactcaaggagcctcctggagtcaacgtatcagcggaaagctgagcagctaatgtcagat
gagaattgctttaagcttatgtttattcagagccaaggccaggtccagctgactattgag
cttctggacacagaagaggagaattcggatgaccctgtggaagcagagcgctggtcagac
tacgtggagcgatacatgaattcagatactacctcgcctgagcttcgtgaacatctagca
cagaaaccagtatttctccccaggaatctacggcggatccggaagtgtcaacgtggtcga
gagcagcaggaaaaggaagggaaggaaggaaacagcaagaagaccatggagaatgtggat
agtctggataagctggagtgtagattcaagctgaattcctacaagatggtgtatgtgatc
aaatcagaggactatatgtatcggaggaccgccctgctccgggctcatcagtcccatgag
cgtgtaagcaagcgtctacatcagagattccaggcctgggtagataaatggaccaaggag
catgtgccccgtgaaatggcagcagagaccagcaagtggctcatgggtgaggggctggag
ggcctggtgccctgtaccaccacctgtgatacagagaccctgcattttgtgagcattaac
aagtatcgtgtcaaatacggcacagtattcaaagccccttaa

DBGET integrated database retrieval system