KEGG   Homo sapiens (human): 25949Help
Entry
25949             CDS       T01001                                 

Gene name
SYF2, CBPIN, NTC31, P29, fSAP29
Definition
SYF2 pre-mRNA-splicing factor
Orthology
K12868  
pre-mRNA-splicing factor SYF2
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    25949 (SYF2)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    25949 (SYF2)
 Complex C
    25949 (SYF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1p36.11
AA seq 243 aa AA seqDB search
MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDK
RLKLPANWEAKKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNP
DLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEID
RMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERG
TAV
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcggctatagctgcatccgaggtgctggtggacagcgcggaggaggggtccctcgct
gcggcggcggagctggccgctcagaagcgcgaacagagactgcgcaaattccgggagctg
cacctgatgcggaatgaagctcgtaaattaaatcaccaggaagttgtggaagaagataaa
agactaaaattacctgcaaattgggaagccaaaaaagctcgtttggagtgggaactaaag
gaagaggaaaagaaaaaggaatgtgcggcaagaggagaagactatgagaaagtgaagttg
ctggagatcagtgcagaagatgcagaaagatgggagaggaaaaagaagaggaaaaaccct
gatctgggattttcagattatgctgctgcccagttacgccagtatcatcggttgaccaag
cagatcaaacctgacatggaaacatatgagagactgagagaaaaacatggagaagagttt
ttcccaacatccaatagtcttcttcatggaacacatgtgccttccacagaggaaattgac
aggatggtcatagatctggaaaaacagattgaaaaacgagacaaatatagccggagacgt
ccttataatgatgatgcagatatcgactacattaatgaaaggaatgccaaattcaacaag
aaagctgaaagattctatgggaaatacacagctgaaattaaacagaatttggaaagagga
acagctgtctaa

DBGET integrated database retrieval system