KEGG   Homo sapiens (human): 25949Help
Entry
25949             CDS       T01001                                 

Gene name
SYF2, CBPIN, NTC31, P29, fSAP29
Definition
(RefSeq) SYF2 pre-mRNA splicing factor
  KO
K12868  
pre-mRNA-splicing factor SYF2
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    25949 (SYF2)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    25949 (SYF2)
 Complex C
    25949 (SYF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O95926(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.11
AA seq 243 aa AA seqDB search
MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDK
RLKLPANWEAKKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNP
DLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEID
RMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERG
TAV
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcggctatagctgcatccgaggtgctggtggacagcgcggaggaggggtccctcgct
gcggcggcggagctggccgctcagaagcgcgaacagagactgcgcaaattccgggagctg
cacctgatgcggaatgaagctcgtaaattaaatcaccaggaagttgtggaagaagataaa
agactaaaattacctgcaaattgggaagccaaaaaagctcgtttggagtgggaactaaag
gaagaggaaaagaaaaaggaatgtgcggcaagaggagaagactatgagaaagtgaagttg
ctggagatcagtgcagaagatgcagaaagatgggagaggaaaaagaagaggaaaaaccct
gatctgggattttcagattatgctgctgcccagttacgccagtatcatcggttgaccaag
cagatcaaacctgacatggaaacatatgagagactgagagaaaaacatggagaagagttt
ttcccaacatccaatagtcttcttcatggaacacatgtgccttccacagaggaaattgac
aggatggtcatagatctggaaaaacagattgaaaaacgagacaaatatagccggagacgt
ccttataatgatgatgcagatatcgactacattaatgaaaggaatgccaaattcaacaag
aaagctgaaagattctatgggaaatacacagctgaaattaaacagaatttggaaagagga
acagctgtctaa

KEGG   Homo sapiens (human): 51340Help
Entry
51340             CDS       T01001                                 

Gene name
CRNKL1, CLF, CRN, Clf1, HCRN, MSTP021, SYF3
Definition
(RefSeq) crooked neck pre-mRNA splicing factor 1
  KO
K12869  
crooked neck
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    51340 (CRNKL1)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    51340 (CRNKL1)
 Complex C
    51340 (CRNKL1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     51340 (CRNKL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BZJ0(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
20p11.23
AA seq 848 aa AA seqDB search
MTATVENLTFQKDTLGNAVDKNTSRLELRSYSLAGRHGSTEPLVLAWSSQFRRLTWGCAL
DALHRSPCVAASQHGVTHLIRSSRTPHSTRCRKEDAQPGHHGNGAASVTAQARGQRSVLQ
VPLPVPRSCLFSESFVVSVSSQSRFLASVPGTGVQRSTAADMAASTAAGKQRIPKVAKVK
NKAPAEVQITAEQLLREAKERELELLPPPPQQKITDEEELNDYKLRKRKTFEDNIRKNRT
VISNWIKYAQWEESLKEIQRARSIYERALDVDYRNITLWLKYAEMEMKNRQVNHARNIWD
RAITTLPRVNQFWYKYTYMEEMLGNVAGARQVFERWMEWQPEEQAWHSYINFELRYKEVD
RARTIYERFVLVHPDVKNWIKYARFEEKHAYFAHARKVYERAVEFFGDEHMDEHLYVAFA
KFEENQKEFERVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQY
EEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIANVPPIQEKRHWKRYIYLWINY
ALYEELEAKDPERTRQVYQASLELIPHKKFTFAKMWILYAQFEIRQKNLSLARRALGTSI
GKCPKNKLFKVYIELELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELETILGDIDRAR
AIYELAISQPRLDMPEVLWKSYIDFEIEQEETERTRNLYRRLLQRTQHVKVWISFAQFEL
SSGKEGSLTKCRQIYEEANKTMRNCEEKEERLMLLESWRSFEEEFGTASDKERVDKLMPE
KVKKRRKVQTDDGSDAGWEEYFDYIFPEDAANQPNLKLLAMAKLWKKQQQEKEDAEHHPD
EDVDESES
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaacagtggagaacctaacgttccagaaggacactttgggaaatgctgttgac
aaaaacacatccagattggagctccgttcttactcccttgcagggcgccacggctcgaca
gagccactcgtcctcgcctggtcatcccagttccggaggctgacctggggatgcgccctg
gacgccctgcaccgcagtccttgcgtcgctgctagtcagcacggcgttacccacctcatc
cgcagctccaggacgccgcactccacgcgctgccgcaaggaggacgcgcagcctggtcac
catggaaacggtgccgcctccgtcacggctcaagcgagaggtcaaaggtcagtcctgcaa
gttccgcttccggttccgagatcctgtttgttttctgaaagctttgtggtttcggtgagc
tctcagagccgatttctagcgtccgtgccggggacaggtgtccagaggtcgactgctgca
gacatggcggcctccaccgcggccgggaagcagcggattcccaaagtggccaaggtgaaa
aacaaagccccggctgaggtacagataactgctgaacaactcttaagagaggctaaagaa
agagaacttgagcttcttccacctccacctcaacagaagatcacagatgaagaagaatta
aatgattataaactaaggaaaaggaagacttttgaagataatataagaaaaaacaggact
gtgattagtaactggataaaatacgcacaatgggaagaaagcctaaaggagattcaaagg
gctcgatccatatacgagcgtgctttagatgtagactaccgaaatattacactctggctg
aaatacgcagaaatggaaatgaagaatcgccaagtcaaccatgctcgaaatatctgggac
cgggccataacaacgctgcctcgagttaatcagttctggtacaagtacacgtacatggag
gaaatgttgggaaacgttgccggtgcccggcaggtgtttgagcgctggatggagtggcag
cctgaggagcaagcctggcactcctacatcaactttgagctgagatacaaagaggtggat
cgggcccgcaccatttatgagcgatttgtcctcgtgcaccctgatgttaagaactggatc
aagtatgcccgctttgaagaaaaacatgcttattttgcccatgcacggaaagtgtatgag
agagctgtggaattctttggagatgaacatatggatgagcacctttatgttgcctttgcc
aagtttgaagaaaatcagaaagagtttgaaagggtacgagtgatttacaagtatgccctg
gacagaatttcaaaacaagatgcccaagaactctttaaaaattataccatctttgagaag
aagtttggtgataggcggggtattgaagatatcattgtgagcaaacggagattccagtac
gaagaagaagtgaaggcgaatccacacaattatgatgcatggtttgattacttgcgcttg
gtagaaagtgacgcagaagctgaagccgtgagagaagtctatgaaagggccattgccaat
gtcccacccattcaggagaagaggcactggaagcgctacatttatctttggatcaactat
gcactctatgaagaattggaggcaaaggatcctgagaggacaagacaggtgtatcaagcc
tctttggaactaattcctcacaaaaagttcacatttgccaaaatgtggatactgtatgca
cagtttgaaatacgacagaagaatctgtcattagccagaagagcattgggaacttccata
ggcaaatgtccaaagaacaaattatttaaagtttacatagaattggagctacagcttcga
gaatttgacagatgccggaagctttatgaaaagttcctggaatttggacctgaaaattgt
acctcatggattaaattcgctgaattagagacaatccttggtgatattgacagagcacgg
gcaatctatgaattagccatcagtcagccacgtttagacatgccagaggtgctttggaaa
tcatatattgattttgaaattgagcaggaagaaacagaaagaacacgaaacctttaccgg
cggttgcttcaacggacgcagcatgtcaaggtatggatcagctttgctcagtttgagttg
tcttcaggaaaagaaggaagtttgactaaatgcagacaaatttatgaagaagctaacaaa
accatgcgaaactgtgaagaaaaggaagagagacttatgctgctggaatcttggcgaagt
tttgaagaagaatttggaacagcttcagataaggagagagtagacaaactcatgccagag
aaagtcaagaagagaagaaaggtccagactgatgatgggtctgatgcaggctgggaagaa
tactttgattacatctttccagaagatgctgccaaccaacctaacctcaaactcctggcc
atggccaaactgtggaagaaacagcagcaggaaaaggaggatgctgagcaccatccagat
gaggacgtcgatgagagtgaatcctga

KEGG   Homo sapiens (human): 56949Help
Entry
56949             CDS       T01001                                 

Gene name
XAB2, HCNP, HCRN, NTC90, SYF1
Definition
(RefSeq) XPA binding protein 2
  KO
K12867  
pre-mRNA-splicing factor SYF1
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    56949 (XAB2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     56949 (XAB2)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    56949 (XAB2)
 Complex C
    56949 (XAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9HCS7(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 855 aa AA seqDB search
MVVMARLSRPERPDLVFEEEDLPYEEEIMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERA
LKLLPCSYKLWYRYLKARRAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFL
MDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESA
EEYIEYLKSSDRLDEAAQRLATVVNDERFVSKAGKSNYQLWHELCDLISQNPDKVQSLNV
DAIIRGGLTRFTDQLGKLWCSLADYYIRSGHFEKARDVYEEAIRTVMTVRDFTQVFDSYA
QFEESMIAAKMETASELGREEEDDVDLELRLARFEQLISRRPLLLNSVLLRQNPHHVHEW
HKRVALHQGRPREIINTYTEAVQTVDPFKATGKPHTLWVAFAKFYEDNGQLDDARVILEK
ATKVNFKQVDDLASVWCQCGELELRHENYDEALRLLRKATALPARRAEYFDGSEPVQNRV
YKSLKVWSMLADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFLEEHKYFEESFKA
YERGISLFKWPNVSDIWSTYLTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYA
QLEEEWGLARHAMAVYERATRAVEPAQQYDMFNIYIKRAAEIYGVTHTRGIYQKAIEVLS
DEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDTI
KEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQLA
AEAERDQPLRAQSKILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLE
QQSVPAAVFGSLKED
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgatggcgcgactctcgcggcccgagcggccggaccttgtcttcgaggaagag
gacctcccctatgaggaggaaatcatgcggaaccaattctctgtcaaatgctggcttcgc
tacatcgagttcaaacagggcgccccgaagcccaggctcaatcagctatacgagcgggca
ctcaagctgctgccctgcagctacaaactctggtaccgatacctgaaggcgcgtcgggca
caggtgaagcatcgctgtgtgaccgaccctgcctatgaagatgtcaacaactgtcatgag
agggcctttgtgttcatgcacaagatgcctcgtctgtggctagattactgccagttcctc
atggaccaggggcgcgtcacacacacccgccgcaccttcgaccgtgccctccgggcactg
cccatcacgcagcactctcgaatttggcccctgtatctgcgcttcctgcgctcacaccca
ctgcctgagacagctgtgcgaggctatcggcgcttcctcaagctgagtcctgagagtgca
gaggagtacattgagtacctcaagtcaagtgaccggctggatgaggccgcccagcgcctg
gccaccgtggtgaacgacgagcgtttcgtgtctaaggccggcaagtccaactaccagctg
tggcacgagctgtgcgacctcatctcccagaatccggacaaggtacagtccctcaatgtg
gacgccatcatccgcgggggcctcacccgcttcaccgaccagctgggcaagctctggtgt
tctctcgccgactactacatccgcagcggccatttcgagaaggctcgggacgtgtacgag
gaggccatccggacagtgatgaccgtgcgggacttcacacaggtgtttgacagctacgcc
cagttcgaggagagcatgatcgctgcaaagatggagaccgcctcggagctggggcgcgag
gaggaggatgatgtggacctggagctgcgcctggcccgcttcgagcagctcatcagccgg
cggcccctgctcctcaacagcgtcttgctgcgccaaaacccacaccacgtgcacgagtgg
cacaagcgtgtcgccctgcaccagggccgcccccgggagatcatcaacacctacacagag
gctgtgcagacggtggaccccttcaaggccacaggcaagccccacactctgtgggtggcg
tttgccaagttttatgaggacaacggacagctggacgatgcccgtgtcatcctggagaag
gccaccaaggtgaacttcaagcaggtggatgacctggcaagcgtgtggtgtcagtgcgga
gagctggagctccgacacgagaactacgatgaggccttgcggctgctgcgaaaggccacg
gcgctgcctgcccgccgggccgagtactttgatggttcagagcccgtgcagaaccgcgtg
tacaagtcactgaaggtctggtccatgctcgccgacctggaggagagcctcggcaccttc
cagtccaccaaggccgtgtacgaccgcatcctggacctgcgtatcgcaacaccccagatc
gtcatcaactatgccatgttcctggaggagcacaagtacttcgaggagagcttcaaggcg
tacgagcgcggcatctcgctgttcaagtggcccaacgtgtccgacatctggagcacctac
ctgaccaaattcattgcccgctatgggggccgcaagctggagcgggcacgggacctgttt
gaacaggctctggacggctgccccccaaaatatgccaagaccttgtacctgctgtacgca
cagctggaggaggagtggggcctggcccggcatgccatggccgtgtacgagcgtgccacc
agggccgtggagcccgcccagcagtatgacatgttcaacatctacatcaagcgggcggcc
gagatctatggggtcacccacacccgcggcatctaccagaaggccattgaggtgctgtcg
gacgagcacgcgcgtgagatgtgcctgcggtttgcagacatggagtgcaagctcggggag
attgaccgcgcccgggccatctacagcttctgctcccagatctgtgacccccggacgacc
ggcgcgttctggcagacgtggaaggactttgaggtccggcatggcaatgaggacaccatc
aaggaaatgctgcgtatccggcgcagcgtgcaggccacgtacaacacgcaggtcaacttc
atggcctcgcagatgctcaaggtctcgggcagtgccacgggcaccgtgtctgacctggcc
cctgggcagagtggcatggacgacatgaagctgctggaacagcgggcagagcagctggcg
gctgaggcggagcgtgaccagcccttgcgcgcccagagcaagatcctgttcgtgaggagt
gacgcctcccgggaggagctggcagagctggcacagcaggtcaaccccgaggagatccag
ctgggcgaggacgaggacgaggacgagatggacctggagcccaacgaggttcggctggag
cagcagagcgtgccagccgcagtgtttgggagcctgaaggaagactga

DBGET integrated database retrieval system