KEGG   Homo sapiens (human): 25953Help
Entry
25953             CDS       T01001                                 

Gene name
PNKD, BRP17, DYT8, FPD1, KIPP1184, MR-1, MR1, PDC, PKND1, TAHCCP2
Definition
paroxysmal nonkinesigenic dyskinesia (EC:3.1.2.6)
Organism
hsa  Homo sapiens (human)
Disease
H00831  
Primary dystonia
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q35
AA seq 142 aa AA seqDB search
MAAVVAATALKGRGARNARVLRGILAGATANKASHNRTRALQSHSSPEGKEEPEPLSPEL
EYIPRKRGKNPMKAVGLAWAIGFPCGILLFILTKREVDKDRVKQMKARQNMRLSNTGEYE
SQRFRASSQSAPSPDVGSGVQT
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtagctgctacggcgctgaagggccggggggcgagaaatgcccgcgtc
ctccgggggattctcgcaggagccacagctaacaaggcttctcataacaggacccgggcc
ctgcaaagccacagctccccagagggcaaggaggaacctgaacccctatccccggagctg
gaatacattcccagaaagaggggcaagaaccccatgaaagctgtgggactggcctgggcc
atcggcttcccttgtggtatcctcctcttcatcctcaccaagcgggaagtggacaaggac
cgtgtgaagcagatgaaggctcggcagaacatgcggttgtccaacacgggcgagtatgag
agccagaggttcagggcttcctcccagagtgccccgtcccctgatgttgggtctggggtg
cagacctga

DBGET integrated database retrieval system