KEGG   Homo sapiens (human): 25956Help
Entry
25956             CDS       T01001                                 

Gene name
SEC31B, SEC31B-1, SEC31L2
Definition
(RefSeq) SEC31 homolog B, COPII coat complex component
  KO
K14005  
protein transport protein SEC31
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Module
COPII complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    25956 (SEC31B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q24.31
AA seq 1179 aa AA seqDB search
MKLKELERPAVQAWSPASQYPLYLATGTSAQQLDSSFSTNGTLEIFEVDFRDPSLDLKHR
GVLSALSRFHKLVWGSFGSGLLESSGVIVGGGDNGMLILYNVTHILSSGKEPVIAQKQKH
TGAVRALDLNPFQGNLLASGASDSEIFIWDLNNLNVPMTLGSKSQQPPEDIKALSWNRQA
QHILSSAHPSGKAVVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDIATQLVLCSEDDRLPV
IQLWDLRFASSPLKVLESHSRGILSVSWSQADAELLLTSAKDSQILCRNLGSSEVVYKLP
TQSSWCFDVQWCPRDPSVFSAASFNGWISLYSVMGRSWEVQHMRQADKISSSFSKGQPLP
PLQVPEQVAQAPLIPPLKKPPKWIRRPTGVSFAFGGKLVTFGLPSTPAHLVPQPCPRLVF
ISQVTTESEFLMRSAELQEALGSGNLLNYCQNKSQQALLQSEKMLWQFLKVTLEQDSRMK
FLKLLGYSKDELQKKVATWLKSDVGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASAS
SAFFDELVPQNMTPWEIPITKDIDGLLSQALLLGELGPAVELCLKEERFADAIILAQAGG
TDLLKQTQERYLAKKKTKISSLLACVVQKNWKDVVCTCSLKNWREALALLLTYSGTEKFP
ELCDMLGTRMEQEGSRALTSEARLCYVCSGSVERLVECWAKCHQALSPMALQDLMEKVMV
LNRSLEQLRGPHGVSPGPATTYRVTQYANLLAAQGSLATAMSFLPRDCAQPPVQQLRDRL
FHAQGSAVLGQQSPPFPFPRIVVGATLHSKETSSYRLGSQPSHQVPTPSPRPRVFTPQSS
PAMPLAPSHPSPYQGPRTQNISDYRAPGPQAIQPLPLSPGVRPASSQPQLLGGQRVQVPN
PVGFPGTWPLPGSPLPMACPGIMRPGSTSLPETPRLFPLLPLRPLGPGRMVSHTPAPPAS
FPVPYLPGDPGAPCSSVLPTTGILTPHPGPQDSWKEAPAPRGNLQRNKLPETFMPPAPIT
APVMSLTPELQGILPSQPPVSSVSHAPPGVPGELSLQLQHLPPEKMERKELPPEHQSLKS
SFEALLQRCSLSATDLKTKRKLEEAAQRLEYLYEKLCEGTLSPHVVAGLHEVARCVDAGS
FEQGLAVHAQVAGCSSFSEVSSFMPILKAVLIIAHKLLV
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaggaacttgagcggccagctgtccaggcatggagcccagccagccaatac
cctttgtatctggccacaggaacatctgcccaacagctagattcctccttcagcacaaat
ggcacattggaaatatttgaggttgatttcagggacccttctctggacttgaaacacaga
ggagtcctttctgccttgagcaggtttcacaagctggtctgggggagctttggcagtggg
cttctggaaagctccggggttattgttggcggcggggacaatggcatgcttattctatac
aatgtgacccacatcctgtcttcggggaaggagcctgtgattgctcagaaacagaagcac
acgggggctgtcagagccctcgacttgaatcctttccagggcaacctcctggcttcaggg
gccagcgattctgaaatcttcatttgggatctgaataacttgaatgtgccaatgaccctg
ggatccaagtcacagcagcctccagaggacatcaaggcactgtcttggaaccggcaagcc
caacacattctgtcttctgctcaccccagtggcaaggcagttgtgtgggatctcaggaag
aatgaacctatcatcaaagtcagtgatcacagcaacaggatgcactgctcaggcctggcc
tggcatcctgacatagccacccagttagtgctgtgctcagaggatgatcgacttcccgtg
attcagctgtgggacttgcgctttgcctcctcgcccttgaaggtgctggagagccacagc
agggggatcttgtcagtgtcatggagccaggctgatgctgagctgctgctcactagtgct
aaggacagccagatcttgtgccggaacctggggagcagtgaggtggtatataagctacca
acacagagcagctggtgctttgatgtgcagtggtgccctcgggacccttcagtgttctct
gctgcctccttcaacggctggatcagtttgtactctgtgatgggtaggagctgggaagtc
cagcatatgagacaggctgacaagatctcctcttccttcagcaaaggccagcctctccca
ccactgcaggtgccagagcaagtggcacaagcaccactgatacctcccctgaaaaaaccc
cccaaatggattagaagaccaacaggtgtttcatttgcttttggagggaagctggttact
tttggcctccccagcacccctgcccatctggtgccacagccttgcccccgcctagtcttc
atcagtcaagtcaccacagaatctgaattcctgatgcgatcagctgagctgcaggaggcc
ttgggatcaggaaatctactgaattactgtcagaacaagagccagcaagctttactgcaa
agtgaaaagatgctgtggcagttcctgaaggtgaccttagagcaagactccagaatgaaa
ttcctaaagcttttaggatacagtaaagatgagcttcagaagaaggtggccacatggttg
aagagtgacgtggggctaggtgagagtcctcagcccaagggaaatgacctcaacagtgac
agacaacaggccttctgcagccaggcctccaaacacaccacaaaggaagcctctgcttcc
tcagccttctttgatgagctggtccctcagaacatgactccttgggagatccccatcaca
aaagatattgatggactcctaagccaggctctcctgcttggggaactgggtccggccgtg
gagctgtgtctgaaggaggagcgctttgctgatgccattatcctggcccaggctgggggt
acagatctgctgaagcaaacacaggagcgctacttggccaagaagaaaaccaaaatctcc
tcgcttctagcctgtgttgtgcaaaagaattggaaggatgtggtgtgtacctgtagcctg
aagaactggagagaggcactggctttgctactgacatactcaggcacagagaaatttccc
gagctctgtgacatgctgggaactcgcatggaacaggagggcagcagggcactaacctcc
gaagccagactctgttatgtgtgctcagggagtgtggagcggctggtggagtgctgggca
aaatgccaccaggctttgtcccccatggctctgcaggacctgatggagaaggtgatggtt
cttaacaggagcttggagcaactgcggggtcctcatggggtgagcccaggccctgccaca
acctacagggtcactcagtatgccaacctcctggcagcccagggcagcctggccactgcc
atgagctttctacccagggactgtgctcagccaccagttcagcagctaagagatcggctt
tttcatgctcaaggttctgctgtcttgggccaacagtctccccctttccccttcccccgg
attgttgtgggagctaccctccactctaaagagacatcatcttacagattgggatcccag
ccttctcaccaggtcccaactccatctccaaggccaagggttttcacccctcagtcatca
ccagcgatgcccttggcaccttcccatcctagcccttatcagggtcccaggacacagaat
ataagtgactacagggcacctgggccccaggccatccagcctttgcctttgagccctggg
gtaaggcctgcttcatctcagccacagctattaggagggcaaagggtgcaagttcctaac
ccggtgggattccctgggacatggcctcttcctggttcccctctacccatggcatgccca
ggcatcatgcgacctggctctacctccctgcctgagactcctagactgttccctctgctt
cctctgagaccactaggtcccggccgcatggtctcccacaccccagcccctcctgcaagc
ttccctgtgccataccttccaggggacccaggtgccccatgctctagtgtcctcccaacc
actggcatcttgactcctcacccaggacctcaagattcctggaaagaagccccagccccc
aggggaaacctccagaggaacaagctgccagagacatttatgcccccagcaccaattact
gctccagttatgagcctcacccctgagctacaagggattcttccctcacagccccctgtc
tccagtgtgagtcatgctcccccaggagttccaggagaactcagcctgcagcttcagcac
ctgccacctgagaagatggaaaggaaggagctgcccccagagcatcagtccttgaagagc
agctttgaggcgcttctccaacgctgctccctgtctgcaactgacttaaagacaaaaagg
aagctggaagaggcagcccagcgtctggagtatctatatgagaagctctgtgaggggaca
ctctcacctcatgtcgtggctgggctccatgaggttgcccgatgtgtggatgcaggaagc
tttgagcagggccttgcagtgcatgcccaggtggcgggctgtagcagcttcagcgaggtg
tccagcttcatgcctatcctgaaggctgtcctcatcatcgctcataagctgctggtctaa

DBGET integrated database retrieval system