KEGG   Homo sapiens (human): 2596Help
Entry
2596              CDS       T01001                                 

Gene name
GAP43, B-50, PP46
Definition
(RefSeq) growth associated protein 43
  KO
K20041  
neuromodulin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q13.31
AA seq 238 aa AA seqDB search
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQ
AAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAAT
EQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAAT
TPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgctgtatgagaagaaccaaacaggttgaaaaaaatgatgacgaccaaaagatt
gaacaagatggtatcaaaccagaagataaagctcataaggccgcaaccaaaattcaggct
agcttccgtggacacataacaaggaaaaagctcaaaggagagaagaaggatgatgtccaa
gctgctgaggctgaagctaataagaaggatgaagcccctgttgccgatggggtggagaag
aagggagaaggcaccactactgccgaagcagccccagccactggctccaagcctgatgag
cccggcaaagcaggagaaactccttccgaggagaagaagggggagggtgatgctgccaca
gagcaggcagccccccaggctcctgcatcctcagaggagaaggccggctcagctgagaca
gaaagtgccactaaagcttccactgataactcgccgtcctccaaggctgaagatgcccca
gccaaggaggagcctaaacaagccgatgtgcctgctgctgtcactgctgctgctgccacc
acccctgccgcagaggatgctgctgccaaggcaacagcccagcctccaacggagactggg
gagagcagccaagctgaagagaacatagaagctgtagatgaaaccaaacctaaggaaagt
gcccggcaggacgagggtaaagaagaggaacctgaggctgaccaagaacatgcctga

DBGET integrated database retrieval system