KEGG   Homo sapiens (human): 2597Help
Entry
2597              CDS       T01001                                 

Gene name
GAPDH, G3PD, GAPD, HEL-S-162eP
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa04066  HIF-1 signaling pathway
hsa05010  Alzheimer's disease
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    2597 (GAPDH)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    2597 (GAPDH)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    2597 (GAPDH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     2597 (GAPDH)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    2597 (GAPDH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2597 (GAPDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N OstA
Motif
Other DBs
NCBI-GeneID: 2597
NCBI-ProteinID: NP_001276674
OMIM: 138400
HGNC: 4141
Ensembl: ENSG00000111640
Vega: OTTHUMG00000137379
Pharos: P04406(Tchem)
UniProt: P04406 V9HVZ4
Structure
PDB: 

Jmol
Position
12p13.31
AA seq 335 aa AA seqDB search
MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV
KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI
ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA
ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV
SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG
IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtgaaggtcggagtcaacggatttggtcgtattgggcgcctggtcaccagg
gctgcttttaactctggtaaagtggatattgttgccatcaatgaccccttcattgacctc
aactacatggtttacatgttccaatatgattccacccatggcaaattccatggcaccgtc
aaggctgagaacgggaagcttgtcatcaatggaaatcccatcaccatcttccaggagcga
gatccctccaaaatcaagtggggcgatgctggcgctgagtacgtcgtggagtccactggc
gtcttcaccaccatggagaaggctggggctcatttgcaggggggagccaaaagggtcatc
atctctgccccctctgctgatgcccccatgttcgtcatgggtgtgaaccatgagaagtat
gacaacagcctcaagatcatcagcaatgcctcctgcaccaccaactgcttagcacccctg
gccaaggtcatccatgacaactttggtatcgtggaaggactcatgaccacagtccatgcc
atcactgccacccagaagactgtggatggcccctccgggaaactgtggcgtgatggccgc
ggggctctccagaacatcatccctgcctctactggcgctgccaaggctgtgggcaaggtc
atccctgagctgaacgggaagctcactggcatggccttccgtgtccccactgccaacgtg
tcagtggtggacctgacctgccgtctagaaaaacctgccaaatatgatgacatcaagaag
gtggtgaagcaggcgtcggagggccccctcaagggcatcctgggctacactgagcaccag
gtggtctcctctgacttcaacagcgacacccactcctccacctttgacgctggggctggc
attgccctcaacgaccactttgtcaagctcatttcctggtatgacaacgaatttggctac
agcaacagggtggtggacctcatggcccacatggcctccaaggagtaa

DBGET integrated database retrieval system