KEGG   Homo sapiens (human): 2597Help
Entry
2597              CDS       T01001                                 

Gene name
GAPDH, G3PD, GAPD, HEL-S-162eP
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.12)
  KO
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
HIF-1 signaling pathway
Alzheimer's disease
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    2597 (GAPDH)
   01230 Biosynthesis of amino acids
    2597 (GAPDH)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    2597 (GAPDH)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    2597 (GAPDH)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    2597 (GAPDH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     2597 (GAPDH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2597 (GAPDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 335 aa AA seqDB search
MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV
KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI
ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA
ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV
SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG
IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtgaaggtcggagtcaacggatttggtcgtattgggcgcctggtcaccagg
gctgcttttaactctggtaaagtggatattgttgccatcaatgaccccttcattgacctc
aactacatggtttacatgttccaatatgattccacccatggcaaattccatggcaccgtc
aaggctgagaacgggaagcttgtcatcaatggaaatcccatcaccatcttccaggagcga
gatccctccaaaatcaagtggggcgatgctggcgctgagtacgtcgtggagtccactggc
gtcttcaccaccatggagaaggctggggctcatttgcaggggggagccaaaagggtcatc
atctctgccccctctgctgatgcccccatgttcgtcatgggtgtgaaccatgagaagtat
gacaacagcctcaagatcatcagcaatgcctcctgcaccaccaactgcttagcacccctg
gccaaggtcatccatgacaactttggtatcgtggaaggactcatgaccacagtccatgcc
atcactgccacccagaagactgtggatggcccctccgggaaactgtggcgtgatggccgc
ggggctctccagaacatcatccctgcctctactggcgctgccaaggctgtgggcaaggtc
atccctgagctgaacgggaagctcactggcatggccttccgtgtccccactgccaacgtg
tcagtggtggacctgacctgccgtctagaaaaacctgccaaatatgatgacatcaagaag
gtggtgaagcaggcgtcggagggccccctcaagggcatcctgggctacactgagcaccag
gtggtctcctctgacttcaacagcgacacccactcctccacctttgacgctggggctggc
attgccctcaacgaccactttgtcaagctcatttcctggtatgacaacgaatttggctac
agcaacagggtggtggacctcatggcccacatggcctccaaggagtaa

DBGET integrated database retrieval system