KEGG   Homo sapiens (human): 2597Help
Entry
2597              CDS       T01001                                 

Gene name
GAPDH, G3PD, GAPD, HEL-S-162eP
Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.12)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
HIF-1 signaling pathway
Alzheimer's disease
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 293 aa AA seqDB search
MVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVF
TTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAK
VIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIP
ELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVV
SSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggtttacatgttccaatatgattccacccatggcaaattccatggcaccgtcaaggct
gagaacgggaagcttgtcatcaatggaaatcccatcaccatcttccaggagcgagatccc
tccaaaatcaagtggggcgatgctggcgctgagtacgtcgtggagtccactggcgtcttc
accaccatggagaaggctggggctcatttgcaggggggagccaaaagggtcatcatctct
gccccctctgctgatgcccccatgttcgtcatgggtgtgaaccatgagaagtatgacaac
agcctcaagatcatcagcaatgcctcctgcaccaccaactgcttagcacccctggccaag
gtcatccatgacaactttggtatcgtggaaggactcatgaccacagtccatgccatcact
gccacccagaagactgtggatggcccctccgggaaactgtggcgtgatggccgcggggct
ctccagaacatcatccctgcctctactggcgctgccaaggctgtgggcaaggtcatccct
gagctgaacgggaagctcactggcatggccttccgtgtccccactgccaacgtgtcagtg
gtggacctgacctgccgtctagaaaaacctgccaaatatgatgacatcaagaaggtggtg
aagcaggcgtcggagggccccctcaagggcatcctgggctacactgagcaccaggtggtc
tcctctgacttcaacagcgacacccactcctccacctttgacgctggggctggcattgcc
ctcaacgaccactttgtcaagctcatttcctggtatgacaacgaatttggctacagcaac
agggtggtggacctcatggcccacatggcctccaaggagtaa

DBGET integrated database retrieval system