KEGG   Homo sapiens (human): 25970Help
Entry
25970             CDS       T01001                                 

Gene name
SH2B1, PSM, SH2B
Definition
SH2B adaptor protein 1
Orthology
K12459  
SH2B adaptor protein 1/3
Organism
hsa  Homo sapiens (human)
Pathway
Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    25970 (SH2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 756 aa AA seqDB search
MNGAPSPEDGASPSSPPLPPPPPPSWREFCESHARAAALDFARRFRLYLASHPQYAGPGA
EAAFSRRFAELFLQHFEAEVARASGSLSPPILAPLSPGAEISPHDLSLESCRVGGPLAVL
GPSRSSEDLAGPLPSSVSSSSTTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGTVDPPS
SAGPLETSSGPPVLGGNSNSNSSGGAGTVGRGLVSDGTSPGERWTHRFERLRLSRGGGAL
KDGAGMVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEG
GGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVD
AQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPS
QDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEE
GPPTGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQL
VLTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDM
LEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQEPTTSHDPPQPPEPPSWTDPPQPGAEEA
SRAPEVAAAAAAAAKERQEKEKAGGGGVPEELVPVVELVPVVELEEAIAPGSEAQGAGSG
GDAGVPPMVQLQQSPLGGDGEEGGHPRAINNQYSFV
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtgccccttccccagaggacggggcctccccctcgtctcccccgctgccccca
cccccgccccctagttggcgggagttctgtgagtcccacgcccgggctgcggctctggac
tttgcccgccgttttcgcctctacctggcctcccacccccaatatgcggggcccggggcc
gaggctgccttctcccgccgttttgctgagctcttcctgcagcactttgaagccgaggtg
gcccgggcctctggctccctgtcgccacccatcctggctcccctgagccctggtgcggag
atttcgccacatgacctgtcccttgagagctgcagggtgggtgggcccctggctgtgctg
ggcccttctcgatcatctgaggacctggccggccccctcccttcctcagtctcttcctcc
tctacaacctcctccaagccgaagctcaagaagcgcttttccctgcgttcagtgggtcgc
tctgtccgaggctcagtccgtggcatcctgcagtggcgggggaccgttgaccctccctcc
tccgctgggcccctggagacctcgtcaggccccccagtcttaggtggaaacagcaactcc
aactcctctggcggggctgggaccgttggtaggggactggtcagtgatggaacgtcccct
ggggaaagatggactcaccgttttgagaggctgagactcagtcggggagggggcgccttg
aaggatggagcagggatggtgcagagggaagagctgctgagtttcatgggggctgaggag
gcagcccctgacccagccggagtgggccggggaggaggggtggctgggcctccttcaggg
ggaggagggcagcctcagtggcagaagtgtcgcctgctgcttcgaagtgaaggagaagga
ggaggaggaagtcgcctggagttctttgtaccacccaaggcctctcggccccgactcagc
atcccctgctcttctatcacagacgtccggacaaccacagccctggagatgcctgaccgg
gagaacacgtttgtggttaaggtggaaggtccatccgagtatatcatggagacagtggat
gcccagcatgtgaaggcctgggtgtctgacatccaagaatgcctgagcccaggaccctgc
cctgctaccagtccccgccccatgaccctccctctggcccctgggacctcattccttaca
agggagaacacagacagcctggagctgtcctgcctgaatcactcggagagtctacccagc
caggacctgctgcttggacccagcgagagcaatgaccgcctgtcgcagggggcatatggg
ggcctctcagaccgcccctcggcatccatctcccccagctctgcctccattgccgcctcc
cattttgactcgatggaactgcttcccccagagttgcccccccgcatccccattgaagag
ggacccccaacagggacagttcatcccctctcagccccctaccctcccttggacactccg
gaaacagccacagggtccttcctgttccagggggagccagagggcggtgagggggaccag
cccctctcagggtatccttggttccacgggatgctctctcggctcaaggctgcacagttg
gtgctgactggcggcactggctcccacggtgtcttcctggtgcgccagagtgagacaagg
cggggtgaatacgtcctcaccttcaacttccagggcaaggccaagcacctgcgtttgtcg
ctgaacgaggagggtcagtgccgggtccagcacctgtggttccagtccattttcgatatg
ctcgagcacttccgggtgcaccccatccctttggagtcgggaggctccagtgatgttgtc
cttgtcagctatgtcccatcctcccagcgacagcaggaaccgaccacctcccatgaccca
ccccagccccctgaacccccttcatggacagatcccccacagcctggggcagaagaggcg
tcgagggcgccagaagtggcggcagcagcagccgcagcagccaaagagaggcaagagaaa
gagaaagcgggcggtggaggggtcccggaagagctggtccccgtggttgagctggtcccc
gtggttgaattggaagaggccatagccccaggctcagaggcccagggcgctgggtctggt
ggggacgcgggggtgcccccaatggtgcagctgcagcagtcaccactagggggtgatgga
gaggaagggggccaccccagggccattaacaaccagtactccttcgtgtga

DBGET integrated database retrieval system