KEGG   Homo sapiens (human): 25989Help
Entry
25989             CDS       T01001                                 

Gene name
ULK3
Definition
unc-51 like kinase 3 (EC:2.7.11.1)
Orthology
K08269  
serine/threonine-protein kinase ULK/ATG1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    25989 (ULK3)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    25989 (ULK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     25989 (ULK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  ULK family [OT]
   25989 (ULK3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    25989 (ULK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24.1
AA seq 472 aa AA seqDB search
MAGPGWGPPRLDGFILTERLGSGTYATVYKAYAKKDTREVVAIKCVAKKSLNKASVENLL
TEIEILKGIRHPHIVQLKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQ
LASALQFLHERNISHLDLKPQNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYM
APEMVCQRQYDARVDLWSMGVILYEALFGQPPFASRSFSELEEKIRSNRVIELPLRPLLS
RDCRDLLQRLLERDPSRRISFQDFFAHPWVDLEHMPSGESLGRATALVVQAVKKDQEGDS
AAALSLYCKALDFFVPALHYEVDAQRKEAIKAKVGQYVSRAEELKAIVSSSNQALLRQGT
SARDLLREMARDKPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPG
RRRELLHTEVQNLMARAEYLKEQVKMRESRWEADTLDKEGLSESVRSSCTLQ
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggcggggcccggctggggtcccccgcgcctggacggcttcatcctcaccgagcgcctg
ggcagcggcacgtacgccacggtgtacaaggcctacgccaagaaggacactcgtgaagtg
gtagccataaagtgtgtagccaagaaaagtctgaacaaggcatcggtggagaacctcctc
acggagattgagatcctcaagggcattcgacatccccacattgtgcagctgaaagacttt
cagtgggacagtgacaatatctacctcatcatggagttttgcgcagggggcgacctgtct
cgcttcatccatacccgcaggattctgcctgagaaggtggcgcgtgtcttcatgcagcaa
ttagctagcgccctgcaattcctgcatgaacggaatatctctcacctggatctgaagcca
cagaacattctactgagctccttggagaagccccacctaaaactggcagactttggtttc
gcacaacacatgtccccgtgggatgagaagcacgtgctccgtggctcccccctctacatg
gcccccgagatggtgtgccagcggcagtatgacgcccgcgtggacctctggtccatgggg
gtcatcctgtatgaagccctcttcgggcagcccccctttgcctccaggtcgttctcggag
ctggaagagaagatccgtagcaaccgggtcatcgagctccccttgcggcccctgctctcc
cgagactgccgggacctactgcagcggctcctggagcgggaccccagccgtcgcatctcc
ttccaggacttttttgcgcacccctgggtggacctggagcacatgcccagtggggagagt
ctggggcgagcaaccgccctggtggtgcaggctgtgaagaaagaccaggagggggattca
gcagctgccttatcactctactgcaaggctctggacttctttgtacctgccctgcactat
gaagtggatgcccagcggaaggaggcaattaaggcaaaggtggggcagtacgtgtcccgg
gctgaggagctcaaggccatcgtctcctcttccaatcaggccctgctgaggcaggggacc
tctgcccgagacctgctcagagagatggcccgggacaagccacgcctcctagctgccctg
gaagtggcttcagctgccatggccaaggaggaggccgccggcggggagcaggatgccctg
gacctgtaccagcacagcctgggggagctactgctgttgctggcagcggagcccccgggc
cggaggcgggagctgcttcacactgaggttcagaacctcatggcccgagctgaatacttg
aaggagcaggtcaagatgagggaatctcgctgggaagctgacaccctggacaaagaggga
ctgtcggaatctgttcgtagctcttgcacccttcagtga

DBGET integrated database retrieval system