KEGG   Homo sapiens (human): 25996Help
Entry
25996             CDS       T01001                                 

Gene name
REXO2, CGI-114, REX2, RFN, SFN
Definition
(RefSeq) RNA exonuclease 2
  KO
K13288  
oligoribonuclease [EC:3.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    25996 (REXO2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     25996 (REXO2)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     25996 (REXO2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    25996 (REXO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q23.2
AA seq 237 aa AA seqDB search
MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQI
IEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQA
EYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWY
PEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgctaggcggctccctgggctccaggctgttgcggggtgtaggtgggagtcacggacgg
ttcggggcccgaggtgtccgcgaaggtggcgcagccatggcggcaggggagagcatggct
cagcggatggtctgggtggacctggagatgacaggattggacattgagaaggaccagatt
attgagatggcctgtctgataactgactctgatctcaacattttggctgaaggtcctaac
ctgattataaaacaaccagatgagttgctggacagcatgtcagattggtgtaaggagcat
cacgggaagtctggccttaccaaggcagtgaaggagagtacaattacattgcagcaggca
gagtatgaatttctgtcctttgtacgacagcagactcctccagggctctgtccacttgca
ggaaattcagttcatgaagataagaagtttcttgacaaatacatgccccagttcatgaaa
catcttcattatagaataattgatgtgagcactgttaaagaactgtgcagacgctggtat
ccagaagaatatgaatttgcaccaaagaaggctgcttctcatagggcacttgatgacatt
agtgaaagcatcaaagagcttcagttttaccgaaataacatcttcaagaaaaaaatagat
gaaaagaagaggaaaattatagaaaatggggaaaatgagaagaccgtgagttga

DBGET integrated database retrieval system