KEGG   Homo sapiens (human): 26007Help
Entry
26007             CDS       T01001                                 

Gene name
DAK, NET45
Definition
dihydroxyacetone kinase 2 homolog (S. cerevisiae) (EC:2.7.1.29 4.6.1.15 2.7.1.28)
Orthology
K00863  
dihydroxyacetone kinase [EC:2.7.1.29]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Metabolic pathways
Carbon metabolism
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    26007 (DAK)
  Lipid metabolism
   00561 Glycerolipid metabolism
    26007 (DAK)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    26007 (DAK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.29  glycerone kinase
     26007 (DAK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.2
AA seq 575 aa AA seqDB search
MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHE
PAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGL
AREQARAEGIPVEMVVIGDDSAFTVLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEIAKQ
VNVVAKAMGTLGVSLSSCSVPGSKPTFELSADEVELGLGIHGEAGVRRIKMATADEIVKL
MLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGRGVKIARALV
GTFMSALEMPGISLTLLLVDEPLLKLIDAETTAAAWPNVAAVSITGRKRSRVAPAEPQEA
PDSTAAGGSASKRMALVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEWLK
EGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTSLPAWSAAMDAGLE
AMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAG
AGRASYISSARLEQPDPGAVAAAAILRAILEVLQS
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaagaagctggtgaactcggtggctggctgtgctgatgacgctcttgctggc
ctggtggcctgcaaccccaacctgcagctcctgcagggccaccgcgtggccctccgttct
gacctggacagcctcaagggccgggtggcactgctgtcgggtgggggctctggccatgag
cctgcccatgctggtttcatagggaaggggatgctgactggggtcatcgcgggagctgtg
ttcacctccccggcagtgggcagcatcctggcagccatcagggccgtggcccaggccggc
acagtggggacgctccttatcgtgaagaactacactggggatcggctcaacttcggcctg
gcccgggagcaggcccgggctgaaggcatcccggtggagatggtggtgattggggacgac
agcgccttcactgtcctgaagaaggcaggccggcgggggctgtgcggcacggtgcttata
cacaaggtggcaggtgctctggctgaggctggtgtggggctggaggagatcgcaaagcag
gtgaacgtggtcgccaaggccatgggtaccctgggggtgagcttatcctcctgcagcgtc
cctggttccaaacccaccttcgagctctcagccgacgaggtggagctgggcctggggatc
cacggggaagctggtgtgcgccggataaagatggcaaccgccgatgagattgtgaaactc
atgctcgaccacatgacaaacaccaccaacgcgtcccatgtgcctgtgcagcccggctcc
tcagttgtgatgatggtcaacaacctgggtggcctgtcattcctggaactgggcatcata
gccgacgctaccgtccgctccctggagggccgcggggtgaagattgcccgtgccctggtg
ggcaccttcatgtcagcactggagatgcctggcatttctctcaccctcctgctggtggat
gagcctctcctgaaactgatagatgctgaaaccactgcagcagcctggcctaacgtggct
gcagtctccattactgggcggaagcggagccgggtagcccctgccgagccccaggaggcc
cctgattccactgctgcaggaggctcagcctcgaagcggatggcgctggtgctggaacgg
gtgtgcagcactctcctgggcctggaggaacacctgaatgccctggaccgggctgctggt
gacggcgactgtggcaccacccacagccgtgcggccagagcaatccaggagtggctgaag
gagggcccaccccctgccagccctgcccagctgctctccaagttgtctgtcctgctcctg
gagaagatgggaggctcatctggggcgctctatggcctgttcctgactgcggctgcacag
cccctgaaggccaagaccagcctcccagcctggtctgctgccatggatgccggcctggaa
gccatgcagaagtatggcaaggctgctccaggggacaggactatgctggattctctgtgg
gcagcggggcaggagctccaagcctggaagagcccaggagctgatctgttacaagtcctg
accaaagcagtcaagagtgccgaagctgcagccgaggccaccaagaatatggaagctgga
gccggaagagccagttatatcagctcagcacggctggagcagccagaccccggggcggtg
gcagctgctgccatcctccgggccatcttggaggtcttgcagagctag

DBGET integrated database retrieval system