KEGG   Homo sapiens (human): 26019Help
Entry
26019             CDS       T01001                                 

Gene name
UPF2, HUPF2, RENT2, smg-3
Definition
(RefSeq) UPF2 regulator of nonsense transcripts homolog (yeast)
  KO
K14327  
regulator of nonsense transcripts 2
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Module
Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    26019 (UPF2)
   03015 mRNA surveillance pathway
    26019 (UPF2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     26019 (UPF2)
   mRNA cycle factors
    P-body specific factors
     26019 (UPF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p14-p13
AA seq 1272 aa AA seqDB search
MPAERKKPASMEEKDSLPNNKEKDCSERRTVSSKERPKDDIKLTAKKEVSKAPEDKKKRL
EDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQAKRQQEEEAAAQ
MKEKEESIQLHQEAWERHHLRKELRSKNQNAPDSRPEENFFSRLDSSLKKNTAFVKKLKT
ITEQQRDSLSHDFNGLNLSKYIAEAVASIVEAKLKISDVNCAVHLCSLFHQRYADFAPSL
LQVWKKHFEARKEEKTPNITKLRTDLRFIAELTIVGIFTDKEGLSLIYEQLKNIINADRE
SHTHVSVVISFCRHCGDDIAGLVPRKVKSAAEKFNLSFPPSEIISPEKQQPFQNLLKEYF
TSLTKHLKRDHRELQNTERQNRRILHSKGELSEDRHKQYEEFAMSYQKLLANSQSLADLL
DENMPDLPQDKPTPEEHGPGIDIFTPGKPGEYDLEGGIWEDEDARNFYENLIDLKAFVPA
ILFKDNEKSCQNKESNKDDTKEAKESKENKEVSSPDDLELELENLEINDDTLELEGGDEA
EDLTKKLLDEQEQEDEEASTGSHLKLIVDAFLQQLPNCVNRDLIDKAAMDFCMNMNTKAN
RKKLVRALFIVPRQRLDLLPFYARLVATLHPCMSDVAEDLCSMLRGDFRFHVRKKDQINI
ETKNKTVRFIGELTKFKMFTKNDTLHCLKMLLSDFSHHHIEMACTLLETCGRFLFRSPES
HLRTSVLLEQMMRKKQAMHLDARYVTMVENAYYYCNPPPAEKTVKKKRPPLQEYVRKLLY
KDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQED
VGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFG
VNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLE
VWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVNDKDSK
DSMTEGENLEEDEEEEEGGAETEEQSGNESEVNEPEEEEGSDNDDDEGEEEEEENTDYLT
DSNKENETDEENTEVMIKGGGLKHVPCVEDEDFIQALDKMMLENLQQRSGESVKVHQLDV
AIPLHLKSQLRKGPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWN
QQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPN
ADLIFKTGGRRR
NT seq 3819 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgagcgtaaaaagccagcaagtatggaagaaaaagactctttaccaaacaac
aaggaaaaagactgcagtgaaaggcggacagtgagcagcaaggagaggccaaaagacgat
atcaagctcactgccaagaaggaggtcagcaaggcccctgaagacaagaagaagagactg
gaagatgataagagaaaaaaggaagacaaggaacgcaagaaaaaagacgaagaaaaggtg
aaggcagaggaagaatcaaagaaaaaagaagaggaagaaaaaaagaaacatcaagaggaa
gagagaaagaagcaagaagagcaggccaaacgtcagcaagaagaagaagcagctgctcag
atgaaagaaaaagaagaatccattcagcttcatcaggaagcttgggaacgacatcattta
agaaaggaacttcgtagcaaaaaccaaaatgctccggacagccgaccagaggaaaacttc
ttcagccgcctcgactcaagtttgaagaaaaatactgcttttgtcaagaaactaaaaact
attacagaacaacagagagactccttgtcccatgattttaatggcctaaatttaagcaaa
tacattgcagaagctgtagcttccatcgtggaagcaaaactaaaaatctctgatgtgaac
tgtgctgtgcacctctgctctctctttcaccagcgttatgctgactttgccccatcactt
cttcaggtctggaaaaaacattttgaagcaaggaaagaggagaaaacacctaacatcacc
aagttaagaactgatttgcgttttattgcagaattgacaatagttgggattttcactgac
aaggaaggtctttccttaatctatgaacagctaaaaaatattattaatgctgatcgggag
tcccacactcatgtctctgtagtgattagtttctgtcgacattgtggagatgatattgct
ggacttgtaccaaggaaagtaaagagtgctgcagagaagtttaatttgagttttcctcct
agtgagataattagtccagagaaacaacagcccttccagaatcttttaaaagagtacttt
acgtctttgaccaaacacctgaaaagggaccacagggagctccagaatactgagagacaa
aacaggcgcattctacattctaaaggggagctcagtgaagatagacataaacagtatgag
gaatttgctatgtcttaccagaagctgctggcaaattctcaatccttagcagaccttttg
gatgaaaatatgccagatcttcctcaagacaaaccaacaccagaagaacatgggcctgga
attgatatattcacacctggtaaacctggagaatatgacttggaaggtggtatatgggaa
gatgaagatgctcggaatttttatgagaacctcattgatttgaaggcttttgtcccagcc
atcttgtttaaagacaatgaaaaaagttgtcagaataaagagtccaacaaagatgatacc
aaagaggcaaaagaatctaaggagaataaggaggtatcaagtcccgatgatttggaactt
gagttggagaatctagaaattaatgatgacaccttagaattagagggtggagatgaagct
gaagatcttacaaagaaacttcttgatgaacaagaacaagaagatgaggaagccagcact
ggatctcatctcaagctcatagtagatgctttcctacagcagttacccaactgtgtcaac
cgagatctgatagacaaggcagcaatggatttttgcatgaacatgaacacaaaagcaaac
aggaagaagttggtacgggcactcttcatagttcctagacaaaggttggatttgctacca
ttttatgcaagattggttgctacattgcatccctgcatgtctgatgtagcagaggatctt
tgttccatgctgaggggggatttcagatttcatgtacggaaaaaggaccagatcaatatt
gaaacaaagaataaaactgttcgttttataggagaactaactaagtttaagatgttcacc
aaaaatgacacactgcattgtttaaagatgcttctgtcagacttctctcatcaccatatt
gaaatggcatgcaccctgctggagacatgtggacggtttcttttcagatctccagaatct
cacctgaggaccagtgtacttttggagcaaatgatgagaaagaagcaagcaatgcatctt
gatgcgagatacgtcacaatggtagagaatgcatattactactgcaacccacctccagct
gaaaaaaccgtgaaaaagaaacgtcctcctctccaggaatatgtccggaaacttttgtac
aaggatctctctaaggttaccaccgagaaggttttgagacagatgcgaaagctgccctgg
caggaccaagaagtgaaagactatgttatttgttgtatgataaacatctggaatgtgaaa
tataatagtattcattgtgtagccaacctcttagcaggactagtgctctaccaagaggat
gttgggatccacgttgtggatggagtgttagaagatattcgattaggaatggaggttaat
caacctaaatttaatcagaggcgcatcagcagtgccaagttcttaggagaactttacaat
taccgaatggtggaatcagctgttattttcagaactctgtattcttttacctcatttggt
gttaatcctgatggctctccaagttccctggacccacctgagcatcttttcagaattaga
ctcgtatgcactattctggacacatgtggccagtactttgacagaggttccagtaaacga
aaacttgattgtttccttgtatattttcagcgttatgtttggtggaagaaaagtttggag
gtttggacaaaagaccatccatttcctattgatatagattacatgatcagtgatacacta
gaactgctaagaccaaagatcaaactctgtaattctctggaagaatccatcaggcaggta
caagacttggaacgagaattcttaataaaactaggcctagtaaatgacaaagactcaaaa
gattctatgacagaaggagaaaatcttgaagaggatgaagaagaagaagaaggtggggct
gaaacagaagaacaatctggaaatgaaagtgaagtaaatgagccagaagaagaggagggt
tctgataatgatgatgatgagggagaagaagaggaggaagagaatacagattaccttaca
gattccaataaggaaaatgaaaccgatgaagagaatactgaggtaatgattaaaggcggt
ggacttaagcatgtaccttgtgtagaagatgaggacttcattcaagctctggataaaatg
atgctagaaaatctacagcaacgaagtggtgaatctgttaaagtgcaccaactagatgtt
gccattcctttgcatctcaaaagccagctgaggaaagggcccccactgggaggtggggaa
ggagaggctgagtctgcagacacaatgccgtttgtcatgttaacaagaaaaggcaataaa
cagcagtttaagatccttaatgtacccatgtcctctcaacttgctgcaaatcactggaac
cagcaacaggcagaacaagaagagaggatgagaatgaaaaagctcacactagatatcaat
gaacggcaagaacaagaagattatcaagaaatgttgcagtctcttgcacagcgcccagct
ccagcaaacaccaatcgtgagaggcggcctcgctaccaacatccgaagggagcacctaat
gcagatctaatctttaagactggtgggaggagacgttga

DBGET integrated database retrieval system