KEGG   Homo sapiens (human): 260293Help
Entry
260293            CDS       T01001                                 

Gene name
CYP4X1, CYPIVX1
Definition
cytochrome P450, family 4, subfamily X, polypeptide 1 (EC:1.14.14.1)
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Serotonergic synapse
Class
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p33; 1
AA seq 509 aa AA seqDB search
MEFSWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKF
IQDDNMEKLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPL
LGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEV
YEHINSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKL
SPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDESGSS
FSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQ
LGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVW
KNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPD
PTRPLTFPNHFILKPKNGMYLHLKKLSEC
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggaattctcctggctggagacgcgctgggcgcggcccttttacctggcgttcgtgttc
tgcctggccctggggctgctgcaggccattaagctgtacctgcggaggcagcggctgctg
cgggacctgcgccccttcccagcgccccccacccactggttccttgggcaccagaagttt
attcaggatgataacatggagaagcttgaggaaattattgaaaaataccctcgtgccttc
cctttctggattgggccctttcaggcatttttctgtatctatgacccagactatgcaaag
acacttctgagcagaacagatcccaagtcccagtacctgcagaaattctcacctccactt
cttggaaaaggactagcggctctagacggacccaagtggttccagcatcgtcgcctacta
actcctggattccattttaacatcctgaaagcatacattgaggtgatggctcattctgtg
aaaatgatgctggataagtgggagaagatttgcagcactcaggacacaagcgtggaggtc
tatgagcacatcaactcgatgtctctggatataatcatgaaatgcgctttcagcaaggag
accaactgccagacaaacagcacccatgatccttatgcaaaagccatatttgaactcagc
aaaatcatatttcaccgcttgtacagtttgttgtatcacagtgacataattttcaaactc
agccctcagggctaccgcttccagaagttaagccgagtgttgaatcagtacacagataca
ataatccaggaaagaaagaaatccctccaggctggggtaaagcaggataacactccgaag
aggaagtaccaggattttctggatattgtcctttctgccaaggatgaaagtggtagcagc
ttctcagatattgatgtacactctgaagtgagcacattcctgttggcaggacatgacacc
ttggcagcaagcatctcctggatcctttactgcctggctctgaaccctgagcatcaagag
agatgccgggaggaggtcaggggcatcctgggggatgggtcttctatcacttgggaccag
ctgggtgagatgtcgtacaccacaatgtgcatcaaggagacgtgccgattgattcctgca
gtcccgtccatttccagagatctcagcaagccacttaccttcccagatggatgcacattg
cctgcagggatcaccgtggttcttagtatttggggtcttcaccacaaccctgctgtctgg
aaaaacccaaaggtctttgaccccttgaggttctctcaggagaattctgatcagagacac
ccctatgcctacttaccattctcagctggatcaaggaactgcattgggcaggagtttgcc
atgattgagttaaaggtaaccattgccttgattctgctccacttcagagtgactccagac
cccaccaggcctcttactttccccaaccattttatcctcaagcccaagaatgggatgtat
ttgcacctgaagaaactctctgaatgttag

DBGET integrated database retrieval system