KEGG   Homo sapiens (human): 260293Help
Entry
260293            CDS       T01001                                 

Gene name
CYP4X1, CYPIVX1
Definition
cytochrome P450, family 4, subfamily X, polypeptide 1 (EC:1.14.14.1)
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    260293 (CYP4X1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     260293 (CYP4X1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   260293 (CYP4X1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p33; 1
AA seq 509 aa AA seqDB search
MEFSWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKF
IQDDNMEKLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPL
LGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEV
YEHINSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKL
SPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDESGSS
FSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQ
LGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVW
KNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPD
PTRPLTFPNHFILKPKNGMYLHLKKLSEC
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggaattctcctggctggagacgcgctgggcgcggcccttttacctggcgttcgtgttc
tgcctggccctggggctgctgcaggccattaagctgtacctgcggaggcagcggctgctg
cgggacctgcgccccttcccagcgccccccacccactggttccttgggcaccagaagttt
attcaggatgataacatggagaagcttgaggaaattattgaaaaataccctcgtgccttc
cctttctggattgggccctttcaggcatttttctgtatctatgacccagactatgcaaag
acacttctgagcagaacagatcccaagtcccagtacctgcagaaattctcacctccactt
cttggaaaaggactagcggctctagacggacccaagtggttccagcatcgtcgcctacta
actcctggattccattttaacatcctgaaagcatacattgaggtgatggctcattctgtg
aaaatgatgctggataagtgggagaagatttgcagcactcaggacacaagcgtggaggtc
tatgagcacatcaactcgatgtctctggatataatcatgaaatgcgctttcagcaaggag
accaactgccagacaaacagcacccatgatccttatgcaaaagccatatttgaactcagc
aaaatcatatttcaccgcttgtacagtttgttgtatcacagtgacataattttcaaactc
agccctcagggctaccgcttccagaagttaagccgagtgttgaatcagtacacagataca
ataatccaggaaagaaagaaatccctccaggctggggtaaagcaggataacactccgaag
aggaagtaccaggattttctggatattgtcctttctgccaaggatgaaagtggtagcagc
ttctcagatattgatgtacactctgaagtgagcacattcctgttggcaggacatgacacc
ttggcagcaagcatctcctggatcctttactgcctggctctgaaccctgagcatcaagag
agatgccgggaggaggtcaggggcatcctgggggatgggtcttctatcacttgggaccag
ctgggtgagatgtcgtacaccacaatgtgcatcaaggagacgtgccgattgattcctgca
gtcccgtccatttccagagatctcagcaagccacttaccttcccagatggatgcacattg
cctgcagggatcaccgtggttcttagtatttggggtcttcaccacaaccctgctgtctgg
aaaaacccaaaggtctttgaccccttgaggttctctcaggagaattctgatcagagacac
ccctatgcctacttaccattctcagctggatcaaggaactgcattgggcaggagtttgcc
atgattgagttaaaggtaaccattgccttgattctgctccacttcagagtgactccagac
cccaccaggcctcttactttccccaaccattttatcctcaagcccaagaatgggatgtat
ttgcacctgaagaaactctctgaatgttag

DBGET integrated database retrieval system